DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and AT4G12870

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_193023.2 Gene:AT4G12870 / 826899 AraportID:AT4G12870 Length:229 Species:Arabidopsis thaliana


Alignment Length:196 Identity:57/196 - (29%)
Similarity:92/196 - (46%) Gaps:13/196 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 FVCLLLGWVGVATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVP 70
            |.|.:|    .....:|...::|::.:.||||:|||.|..|:..:| ..:...|....||:.|||
plant    13 FACFVL----FTFSHKLVTGESDKVELNLYYESLCPGCQSFIVDEL-VKVFDSDLDTITDVKLVP 72

  Fly    71 YGNARTNDDGNVECQHGVMECELNAWHACILEHHDIAQS-LKLIACMMRGKKNRLEKCADHYQID 134
            :|.|:.:::..|.||||..||:|||..||::......:| .|.|.|:.....|....|...|..:
plant    73 FGYAKVSNNLTVICQHGEEECKLNALEACVINTLPNPKSQYKFIRCVENNTDNWESSCLKGYGNE 137

  Fly   135 VGDVKNCKKTRQVNDILRKYGKETA--KVSFQGVPAVALDNVYNADLSANLTDHFDAIFCAKYKE 197
            .. :.:|..:.....::..|.|:|:  |...:.||.|.::   :..|...|.|....: |..||.
plant   138 KA-INDCYNSDLSKKLILGYAKQTSSLKPKHEFVPWVTIN---SKPLYTKLDDLVGQV-CKAYKG 197

  Fly   198 K 198
            |
plant   198 K 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 36/98 (37%)
AT4G12870NP_193023.2 GILT 34..134 CDD:281251 36/100 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2265
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm8398
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.