DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and si:dkey-197i20.6

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_693944.2 Gene:si:dkey-197i20.6 / 565583 ZFINID:ZDB-GENE-131127-557 Length:256 Species:Danio rerio


Alignment Length:188 Identity:49/188 - (26%)
Similarity:83/188 - (44%) Gaps:28/188 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQADRLAITLYYEALCPYCMEFVTTQLNPS-MVRQDRLPFTDLTLVPYGNAR-TNDDGNVECQHG 87
            |....:.|:||||:||..|..|:|.||.|: .:.:|   ...:.|||:|||: ..::.:..||||
Zfish    62 PVVPPVEISLYYESLCSGCRAFLTEQLFPTWTLLKD---IMKVNLVPFGNAKEVPEENSFSCQHG 123

  Fly    88 VMECELNAWHACILEHHDIAQSLKLIACMMRGKKNRLEKCADHYQ------------IDVGDVKN 140
            ..||..|...||:| :.....:..:|.||        |..||..|            |....:::
Zfish   124 EPECYANMVEACVL-YEATHAAFPVIHCM--------ESSADVTQSAKPCLQLYAPFIKWETIES 179

  Fly   141 CKKTRQVNDILRKYGKET--AKVSFQGVPAVALDNVYNADLSANLTDHFDAIFCAKYK 196
            |.:....:.::.:...:|  .|.:...||.:.::..|.::|..........:.|:.||
Zfish   180 CTRGELGHSLMHQNAVKTQALKPAHTHVPWITINGKYTSELEDKAMSTLFNLVCSLYK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 35/99 (35%)
si:dkey-197i20.6XP_693944.2 SapA <33..54 CDD:295328
GILT 68..168 CDD:281251 37/111 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.