DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and ifi30

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001017196.1 Gene:ifi30 / 549950 XenbaseID:XB-GENE-1002315 Length:256 Species:Xenopus tropicalis


Alignment Length:188 Identity:58/188 - (30%)
Similarity:87/188 - (46%) Gaps:14/188 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNAR-TNDDGN-- 81
            |.|:......:.|.|:||:||..|..|:..||.||.:....:  .::||||||||: ||..|.  
 Frog    49 RDLKKSSEPAIQIDLFYESLCGGCRGFLVRQLFPSWLMLAEI--INVTLVPYGNAQETNITGKWV 111

  Fly    82 VECQHGVMECELNAWHACILEH--HDIAQSLKLIACMMRGKK--NRLEKCADHY--QIDVGDVKN 140
            .:||||..||..|...||:: |  .||.:...:|.||.....  ..||.|...|  ::.:..|..
 Frog   112 FDCQHGPEECLGNMMEACLI-HILDDIYKYFPIIFCMESSNNVTKSLESCLAVYAPELPLKTVLE 175

  Fly   141 CKKTRQVNDILRKYGKETAKVS--FQGVPAVALDNVYNADLSANLTDHFDAIFCAKYK 196
            |......|.::.:..::|..:|  ...||.:.:|.::..||.|........:.|..||
 Frog   176 CVNGDLGNKLMHENAQKTKGLSPPHNYVPWIVIDGMHTDDLQAQAQSSLFNLVCDTYK 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 41/104 (39%)
ifi30NP_001017196.1 GILT 60..161 CDD:281251 40/103 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2953
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.