DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and CG9427

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster


Alignment Length:209 Identity:60/209 - (28%)
Similarity:102/209 - (48%) Gaps:32/209 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFVCLLLGWVGV-ATPRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTL 68
            :.:.|.|||..: ..||..|  |:::|.|||.||:|||....|: .||.|  |.::...:.|:.|
  Fly    11 LLLVLSLGWAKLEEKPREKR--QSNKLHITLLYESLCPDSRNFM-HQLGP--VYEEFGDYIDILL 70

  Fly    69 VPYGNARTNDDGNV-ECQHGVMECELNAWHACILEH-HDIAQSLKLIAC-MMRGKKNRLEKCADH 130
            ||:|.:::..:|.: .||||..||:.|...:|::.. .:.|..:|.:.| |:....:|:::||:.
  Fly    71 VPFGKSQSERNGAIFHCQHGPAECKGNRLQSCVINSTANQAAQVKFVVCQMLAPDYSRIDQCANE 135

  Fly   131 YQIDVGDVKNC-------KKTRQVNDILRKYGKETAKVSFQGVPAVALDNVYNADLSANLTDH-- 186
            ..: :.||.:|       |...|...:.::|..     ||  :|.:    |||......|.||  
  Fly   136 AGL-LTDVVHCLSSETGTKLQLQAELVTKQYSP-----SF--IPTI----VYNGVFDQQLQDHSL 188

  Fly   187 --FDAIFCAKYKEK 198
              |....|...:::
  Fly   189 RDFRGTVCYMLRQQ 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 34/100 (34%)
CG9427NP_649919.1 GILT 36..136 CDD:281251 34/102 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D159048at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
54.920

Return to query results.
Submit another query.