DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and Ifi30

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001025197.1 Gene:Ifi30 / 290644 RGDID:1310758 Length:248 Species:Rattus norvegicus


Alignment Length:163 Identity:51/163 - (31%)
Similarity:79/163 - (48%) Gaps:25/163 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GVAT----------PRRLRGPQADRLAITLYYEALCPYCMEFVTTQLNPS--MVRQDRLPFTDLT 67
            |.||          ||||.  .|..:.::||||:||..|..|:...|.|:  ||    :...::|
  Rat    36 GAATCKAHDLCLFGPRRLL--SAPPVNVSLYYESLCGACRYFLVRNLFPTWLMV----MEIMNIT 94

  Fly    68 LVPYGNAR-TNDDGNVE--CQHGVMECELNAWHACILEHHDIAQSLKLIACM--MRGKKNRLEKC 127
            |||||||: .|..|..|  ||||.:||:||...||:|:..:...:...|.||  |...:.:|..|
  Rat    95 LVPYGNAQERNVSGTWEFTCQHGELECKLNKVEACLLDKLEKEAAFLTIVCMEEMEDMEKKLGPC 159

  Fly   128 ADHY--QIDVGDVKNCKKTRQVNDILRKYGKET 158
            ...|  ::....:..|...::..:::.:..:.|
  Rat   160 LQLYVPEVSPESIMECATGKRGTELMHENAQLT 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 40/104 (38%)
Ifi30NP_001025197.1 GILT 60..163 CDD:281251 40/106 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.