DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and ZK669.2

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001364576.1 Gene:ZK669.2 / 191387 WormBaseID:WBGene00014052 Length:234 Species:Caenorhabditis elegans


Alignment Length:193 Identity:44/193 - (22%)
Similarity:81/193 - (41%) Gaps:26/193 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RRLRGPQADR-----LAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNA---RT 76
            :.:...||.|     :.|..:.|:|||....:....:.|...........::|..|:|.|   |:
 Worm    29 KAMMADQASRAKTPPINIEFFGESLCPDTTRYFRNHIMPVWTSLQASSTINITYHPFGLASCRRS 93

  Fly    77 NDDG-NVECQHGVMECELNAWHACILEHHDIAQ-SLKLIACMMRGK---KNRLEKCADHYQ---- 132
            .:.| ...||||..||:||...||::....:.| .|.::.| |:||   .:.::.|..:::    
 Worm    94 AETGIRCNCQHGPAECQLNMLQACVISTLQVPQLYLPIVNC-MQGKNKFSSAVDDCIVNFRPRPD 157

  Fly   133 IDVGDVKNCKKTRQVNDILRKYG---KETAKVSFQGVPAVALDNVYNADLSANLTDHFDAIFC 192
            :|...:..|.:::....::.::|   ||.|. ....||.:.:    |...|....:....|.|
 Worm   158 LDENFMARCAQSQLGAKLMMQHGYRQKEVAS-ELDWVPWILI----NGRRSQAAENQLKTIVC 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 29/105 (28%)
ZK669.2NP_001364576.1 GILT 45..149 CDD:397369 28/104 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164070
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2953
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.850

Return to query results.
Submit another query.