DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and Y18D10A.2

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_493240.2 Gene:Y18D10A.2 / 189471 WormBaseID:WBGene00012475 Length:212 Species:Caenorhabditis elegans


Alignment Length:173 Identity:43/173 - (24%)
Similarity:66/173 - (38%) Gaps:21/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 CPYCMEFVTTQLNPSMVR-----QDRLPFTDLTLVPYGNARTNDDGNVECQHGVMECELNAWHAC 99
            ||...:|:..||.|....     .|.|.. |...||.|..:.:......|.||.:||.||....|
 Worm    47 CPDTSKFIHNQLVPFYQNYKGNLSDGLKL-DFHAVPTGGHQVDGKYVNRCLHGALECALNKLQMC 110

  Fly   100 ILEHHDIAQSLKLIACMMRGKK--NRLEKCADHYQIDVGD-VKNCKKTRQVNDIL---RKYGKET 158
            ..:|  |.|...:.|..::||.  :...||..  ..:.|. |:||.::.:...:|   ..|....
 Worm   111 SKKH--IKQDWLVTAGCIQGKTAYSAGLKCLP--DTEEGKIVQNCAESEEGEYLLNDENSYRYNV 171

  Fly   159 AKVSFQGVPAVALDNVYNADLSANLTDHFDAIFCAKYKEKFNK 201
            |..| ..:|.:.::...|.:....|.|    :.|.....|.|:
 Worm   172 APHS-AWLPWIQVNGERNRNAEFKLKD----VICQLESMKGNE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 28/96 (29%)
Y18D10A.2NP_493240.2 GILT 39..142 CDD:281251 28/99 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164065
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.820

Return to query results.
Submit another query.