DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT2 and IFI30

DIOPT Version :9

Sequence 1:NP_651166.1 Gene:GILT2 / 42788 FlyBaseID:FBgn0039099 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_006323.2 Gene:IFI30 / 10437 HGNCID:5398 Length:250 Species:Homo sapiens


Alignment Length:190 Identity:56/190 - (29%)
Similarity:85/190 - (44%) Gaps:20/190 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRGP----QADRLAITLYYEALCPYCMEFVTTQLNPSMVRQDRLPFTDLTLVPYGNAR-TNDDGN 81
            ||||    .|..:.:||||||||..|..|:..:|.|:.:..  :...::||||||||: .|..|.
Human    50 LRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLV--MEILNVTLVPYGNAQEQNVSGR 112

  Fly    82 VE--CQHGVMECELNAWHACILEHHDIAQSLKLIACM--MRGKKNRLEKCADHYQ--IDVGDVKN 140
            .|  ||||..||:.|...||:|:..|:..:...|.||  ....:..|..|...|.  :....:..
Human   113 WEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIME 177

  Fly   141 CKKTRQVNDILRKYGKETAKVS--FQGVPAVALDNVYNADLSANLTDHFDAIFCAKYKEK 198
            |....:...::....:.|..:.  .:.||.|.::.....|.:..||     :.|..|:.|
Human   178 CAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLT-----LVCQLYQGK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT2NP_651166.1 GILT 32..130 CDD:308710 39/102 (38%)
IFI30NP_006323.2 GILT 63..164 CDD:308710 39/102 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2953
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.