DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and OSH1

DIOPT Version :9

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_195778.1 Gene:OSH1 / 831721 AraportID:AT5G01580 Length:233 Species:Arabidopsis thaliana


Alignment Length:197 Identity:58/197 - (29%)
Similarity:87/197 - (44%) Gaps:27/197 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CLLLVWPTPGNGQSPDESRLLVAIHYEALCPDSMSFIRRRLYDALQDNDWWSVTDLKLYPFGKAG 76
            |||.:         ....::.::::||||||....||..|| ..:.:....|..||:|.|:|.|.
plant    17 CLLSL---------SSSQKVTLSLYYEALCPFCAEFIVNRL-PKIFETGLISSIDLQLVPWGNAA 71

  Fly    77 FYNNTSTGESQVFCQHGVDECELNALHACIIETL-DIRKAFNLIYC----MLRSYSNELGPCSRS 136
            .     ..:..:.||||..||.|||:|||.|... |:.|.|..|||    :|.:...:...|...
plant    72 I-----RPDGTILCQHGEAECALNAIHACAINAYPDVMKHFGYIYCTEQLVLENKLEKWADCLEM 131

  Fly   137 MGVDVSKARECKASRTTAEILAPYGKETLKL--GISFVPTIVFENDFDPYDQRSIRNNFERHFCR 199
            :|:. ..|.:|..:....::...|.:||.:|  ...|||.:|..|  .|..:.  ..||..:.|.
plant   132 VGLS-RAAVDCYINGYGNQLEQRYAEETSELYPAHRFVPWVVVNN--LPLQEN--YQNFVMYVCN 191

  Fly   200 QY 201
            .|
plant   192 AY 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 33..127 CDD:308710 37/98 (38%)
OSH1NP_195778.1 GILT 29..130 CDD:281251 38/106 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2265
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm8398
orthoMCL 1 0.900 - - OOG6_132507
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.