DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and GILT

DIOPT Version :9

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001154228.1 Gene:GILT / 826908 AraportID:AT4G12960 Length:243 Species:Arabidopsis thaliana


Alignment Length:225 Identity:65/225 - (28%)
Similarity:106/225 - (47%) Gaps:32/225 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLFTLCLLLVWPTPGNGQSPDESRLLVAIHYEALCPDSMSFIRRRLYDALQDNDWWSVTDLKLYP 71
            |:|..||||:..| .|..:....::.:.::||:|||....||...| ..:.|.|.:::|||||:|
plant     9 LVFFGCLLLLTFT-DNLVAGKSGKVKLNLYYESLCPGCQEFIVDDL-GKIFDYDLYTITDLKLFP 71

  Fly    72 FGKAGFYNNTSTGESQVFCQHGVDECELNALHACIIETL-----------DIRKAFNLIYCMLRS 125
            ||.|...:|.:     |.||||.:||:||||.||.:.|.           ..:..::.|.| :.|
plant    72 FGNAELSDNLT-----VTCQHGEEECKLNALEACALRTWPDQFDKCDGYGTQKSQYSFIRC-VES 130

  Fly   126 YSNELGPCSRSMGVDVSKA-RECKASRTTAEILAPYGKET--LKLGISFVPTIVFENDFDPYDQR 187
            .:.....|.::.|.:  || .:|.....:.:::..|..:|  ||....:||.:....  .|.|. 
plant   131 DTKGWESCVKNSGRE--KAINDCYNGDLSRKLILGYATKTKNLKPPHEYVPWVTLNG--KPLDD- 190

  Fly   188 SIR--NNFERHFCRQYLKKFNIKLP-TCSA 214
            |::  ::.....|..|  |....|| .|::
plant   191 SVQSTDDLVAQICNAY--KGKTTLPKVCNS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 33..127 CDD:308710 37/104 (36%)
GILTNP_001154228.1 GILT 33..141 CDD:281251 38/114 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3270
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2265
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm8398
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.