DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and AT4G12900

DIOPT Version :9

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_193026.1 Gene:AT4G12900 / 826902 AraportID:AT4G12900 Length:231 Species:Arabidopsis thaliana


Alignment Length:220 Identity:65/220 - (29%)
Similarity:105/220 - (47%) Gaps:29/220 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLFTLCLLLVWPTPGNGQSPDESRLLVAIHYEALCPDSMSFIRRRLYDALQDNDWWSVTDLKLYP 71
            |:|..||||...:..|..:.:..::.:.::||:|||...:||...| ..:.:.|..::|||||.|
plant    13 LVFFACLLLFTFSSHNLVAGESDKVKLNLYYESLCPSCQNFIVHHL-GKIFNTDLHTITDLKLIP 76

  Fly    72 FGKAGFYNNTSTGESQVFCQHGVDECELNALHACIIETL-DIRKAFNLIYCMLRSYSNELGPCSR 135
            ||.|...::.:     |.||||.:||:||||.||.|.|. :.|..:..|.| :.:.:|....|.:
plant    77 FGNAHVSDDLT-----VTCQHGEEECKLNALEACAIRTWPNQRLHYKFIRC-VETNTNAWESCVK 135

  Fly   136 SMGVDVSKA-RECKASRTTAEILAPYGKETLKL--GISFVPTI------VFENDFDPYDQRSIRN 191
            ..|.:  || .:|.....:.|::..|..:||.|  ...:||.:      ::||..|         
plant   136 KYGGE--KAINDCYNGDLSKELILGYANQTLSLKPEHKYVPWMTLNGEPLYENIGD--------- 189

  Fly   192 NFERHFCRQYLKKFNIKLPTCSAIL 216
             |....|:.|..|..:.....|::|
plant   190 -FVDLVCKAYKGKAALPKLCYSSVL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 33..127 CDD:308710 36/94 (38%)
AT4G12900NP_193026.1 GILT 38..137 CDD:367408 38/105 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3270
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2265
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm8398
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.