DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and AT4G12890

DIOPT Version :9

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_567395.1 Gene:AT4G12890 / 826901 AraportID:AT4G12890 Length:232 Species:Arabidopsis thaliana


Alignment Length:217 Identity:68/217 - (31%)
Similarity:106/217 - (48%) Gaps:23/217 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFGLLFTLCLLLVWPTPGNGQSPDESRLLVAIHYEALCPDSMSFIRRRLYDALQDNDWWSVTDLK 68
            :|..||..||.:...:.....:.:.:::.:.::||:|||...:||...| ..:.|:|...:||||
plant    12 LFPCLFLACLFVFTYSNNLVVAENSNKVKINLYYESLCPYCQNFIVDDL-GKIFDSDLLKITDLK 75

  Fly    69 LYPFGKAGFYNNTSTGESQVFCQHGVDECELNALHACIIETL-DIRKAFNLIYCMLRSYSNELGP 132
            |.|||.|...||.:     :.||||.:||:||||.||.|.|| |.:..:..|.|:.:. :||...
plant    76 LVPFGNAHISNNLT-----ITCQHGEEECKLNALEACGIRTLPDPKLQYKFIRCVEKD-TNEWES 134

  Fly   133 CSRSMGVDVSKA-RECKASRTTAEILAPYGKET--LKLGISFVPTIVFEND--FDPYDQRSIRNN 192
            |.:..|.:  || .:|.....:.:::..|.|.|  ||....:||.:.....  :|.|      :|
plant   135 CVKKSGRE--KAINDCYNGDLSQKLILGYAKLTSSLKPKHEYVPWVTLNGKPLYDNY------HN 191

  Fly   193 FERHFCRQYLKKFNIKLPTCSA 214
            .....|:.|..|...||  ||:
plant   192 LVAQVCKAYKGKDLPKL--CSS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 33..127 CDD:308710 39/94 (41%)
AT4G12890NP_567395.1 GILT 40..139 CDD:367408 42/105 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3270
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2265
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm8398
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.940

Return to query results.
Submit another query.