DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and AT4G12890

DIOPT Version :10

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_567395.1 Gene:AT4G12890 / 826901 AraportID:AT4G12890 Length:232 Species:Arabidopsis thaliana


Alignment Length:201 Identity:41/201 - (20%)
Similarity:76/201 - (37%) Gaps:47/201 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SDQKKKSNERKSSMDFTASIEKVQEFGWYWG--PITSEGAEKILSNEPDGSFL-----------V 56
            |..|.:|.:|..:.:  ..|:|.....:|..  ||:|   ..::.|:.:.::.           .
plant   147 SMSKAQSFDRFDTQE--VGIQKSYSDSFYNNKVPISS---SPMIHNKNNATYFTLYSSTGISDAA 206

  Fly    57 RDSSDDHYIFSLTFKLNGTVRHVRIDQYQGSFSFGSCAKFKSRTIMEFIENAVEH-------SRS 114
            |||.....:.::...|...:|.|| ||....:..|| :..|....:..:....:|       |.:
plant   207 RDSGIVGSLSNIQNNLTEMMRSVR-DQNISLYHLGS-SNIKQNISLNSVPGTYQHRALEPMTSTN 269

  Fly   115 GRYLFFLHR-----RPEYGPMRVQLTKPVSRFKHVQSLQ----HICRFVIHKTIKRKD-----LI 165
            |    ||:.     :|.|....::....:...||:|...    |.|  :.||.:.::|     ..
plant   270 G----FLNNSLICSQPHYNNPGLKSCDNICNIKHLQLYSSCKCHCC--IAHKQVLKEDDTVAAFC 328

  Fly   166 QALPLP 171
            .:||:|
plant   329 HSLPIP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 34..127 CDD:460853 22/117 (19%)
AT4G12890NP_567395.1 GILT 43..137 CDD:460853
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.