DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and AT4G12870

DIOPT Version :9

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_193023.2 Gene:AT4G12870 / 826899 AraportID:AT4G12870 Length:229 Species:Arabidopsis thaliana


Alignment Length:214 Identity:70/214 - (32%)
Similarity:105/214 - (49%) Gaps:24/214 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLFTLCLLLVWPTPGNGQSPDESRLLVAIHYEALCPDSMSFIRRRLYDALQDNDWWSVTDLKLYP 71
            :|||....||     .|:|   .::.:.::||:|||...|||...|.... |:|..::||:||.|
plant    17 VLFTFSHKLV-----TGES---DKVELNLYYESLCPGCQSFIVDELVKVF-DSDLDTITDVKLVP 72

  Fly    72 FGKAGFYNNTSTGESQVFCQHGVDECELNALHACIIETLDIRKA-FNLIYCMLRSYSNELGPCSR 135
            ||.|...||.:     |.||||.:||:||||.||:|.||...|: :..|.|:..:..|....|.:
plant    73 FGYAKVSNNLT-----VICQHGEEECKLNALEACVINTLPNPKSQYKFIRCVENNTDNWESSCLK 132

  Fly   136 SMGVDVSKA-RECKASRTTAEILAPYGKET--LKLGISFVPTIVFENDFDPYDQRSIRNNFERHF 197
            ..|.:  || .:|..|..:.:::..|.|:|  ||....|||.:.. |....|.:   .::.....
plant   133 GYGNE--KAINDCYNSDLSKKLILGYAKQTSSLKPKHEFVPWVTI-NSKPLYTK---LDDLVGQV 191

  Fly   198 CRQYLKKFNIKLPTCSAIL 216
            |:.|..|..:.:...||.|
plant   192 CKAYKGKTPLPIDCSSAAL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 33..127 CDD:308710 40/94 (43%)
AT4G12870NP_193023.2 GILT 34..134 CDD:281251 42/105 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3270
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 91 1.000 Inparanoid score I2265
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D803513at2759
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 1 1.000 - - mtm8398
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X814
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.