DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and Ifi30

DIOPT Version :9

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_075552.2 Gene:Ifi30 / 65972 MGIID:2137648 Length:248 Species:Mus musculus


Alignment Length:216 Identity:62/216 - (28%)
Similarity:96/216 - (44%) Gaps:33/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LCLLLVWPTPGNGQSPDESRLLVAIHYEALCPDSMSFIRRRLYDALQDNDW---WSVTDLKLYPF 72
            :|||...|.|   .||.   :.|:::||:||.....|:.|.|:..     |   ..:.::.|.|:
Mouse    45 VCLLGPRPLP---PSPP---VRVSLYYESLCGACRYFLVRDLFPT-----WLMVMEIMNITLVPY 98

  Fly    73 GKAGFYNNTSTGESQVFCQHGVDECELNALHACIIETLDIRKAFNLIYCM--LRSYSNELGPCSR 135
            |.|...|.:.|.|  ..||||..||.||.:.||:::.|:...||..|.||  :.....:||||.:
Mouse    99 GNAQERNVSGTWE--FTCQHGELECRLNMVEACLLDKLEKEAAFLTIVCMEEMDDMEKKLGPCLQ 161

  Fly   136 SMGVDVS--KARECKASRTTAEILAPYGK--ETLKLGISFVP-TIVFENDF-DPYDQRSIRNNFE 194
            ....:||  ...||...:...:::....:  :.|.....:|| .:|.|... ||.:..||     
Mouse   162 VYAPEVSPESIMECATGKRGTQLMHENAQLTDALHPPHEYVPWVLVNEKPLKDPSELLSI----- 221

  Fly   195 RHFCRQYLKKFNIKLPTCSAI 215
              .|:.|  :...|...||:|
Mouse   222 --VCQLY--QGTEKPDICSSI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 33..127 CDD:308710 32/98 (33%)
Ifi30NP_075552.2 GILT 61..163 CDD:281251 36/108 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.