DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and CG41378

DIOPT Version :9

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001163836.1 Gene:CG41378 / 5740475 FlyBaseID:FBgn0085638 Length:228 Species:Drosophila melanogaster


Alignment Length:214 Identity:60/214 - (28%)
Similarity:97/214 - (45%) Gaps:27/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KIFGLLFTLCLLLV----WPTP-------GNGQSPDESRLLVAIHYEALCPDSMSFIRRRLYDAL 56
            ::|.::..:||.:|    :|.|       |...    .:::|.::||||||||..|:.::|....
  Fly    11 RLFVVVALVCLFIVVLWYYPVPVLTSQLHGGAL----MKVVVTVYYEALCPDSKYFLTKQLLPTF 71

  Fly    57 QDNDWWSVTDLKLYPFGKAGFYNNTSTGESQVFCQHGVDECELNALHACIIETL-DIRKAFNLIY 120
            :...  |:.::||.|:|||  ......|:....||||..||:.|..|||..|.: |......:..
  Fly    72 KIAK--SIMEVKLAPYGKA--KTKEHNGKITFDCQHGPIECQANIYHACAAEIIEDPLLRLEVAT 132

  Fly   121 CML---RSYSNELGPCSRSMGVDVSKARECKASRTTAEILAPYGKET--LKLGISFVPTIVFEND 180
            ||:   .|....:..|:..:..|.|..:.|..|....::|...|:.|  |:..|:|:|||..  |
  Fly   133 CMIMDNHSPQEAMNKCTSQINFDDSVIQNCFESYRGVDLLKVIGESTNSLRPPITFIPTITI--D 195

  Fly   181 FDPYDQRSIRNNFERHFCR 199
            .....|.||..:.....|:
  Fly   196 GSQGRQESILKDLLSEVCK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 33..127 CDD:308710 34/97 (35%)
CG41378NP_001163836.1 GILT 47..152 CDD:281251 35/108 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462258
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D159048at6656
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
76.850

Return to query results.
Submit another query.