DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and si:dkey-197i20.6

DIOPT Version :9

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_693944.2 Gene:si:dkey-197i20.6 / 565583 ZFINID:ZDB-GENE-131127-557 Length:256 Species:Danio rerio


Alignment Length:280 Identity:60/280 - (21%)
Similarity:93/280 - (33%) Gaps:96/280 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNKIFGLLFTLCLLLV-------WPTPGNGQSPDE----------------------SRL----- 31
            ||.:...:|.:..|.|       .|.|..|..|.:                      |||     
Zfish     1 MNTLVLFVFHVLFLGVHKIQCKSHPKPSCGYPPSQWCRSLEIAIECEVQKQCMELNASRLDPVVP 65

  Fly    32 --LVAIHYEALCPDSMSFIRRRLYDALQDNDWWSVTDL---KLYPFGKAGFYNNTSTGESQVFCQ 91
              .::::||:||....:|:..:|:..     |..:.|:   .|.|||.|    .....|:...||
Zfish    66 PVEISLYYESLCSGCRAFLTEQLFPT-----WTLLKDIMKVNLVPFGNA----KEVPEENSFSCQ 121

  Fly    92 HGVDECELNALHACIIETLDIRKAFNLIYCMLRSYSNELGPCSRSMGVDVSK-ARECKASRTTAE 155
            ||..||..|.:.||::... ...||.:|:||..|             .||:: |:.|      .:
Zfish   122 HGEPECYANMVEACVLYEA-THAAFPVIHCMESS-------------ADVTQSAKPC------LQ 166

  Fly   156 ILAPYGK------------------------ETLKLGISFVPTIVFENDFDPYDQRSIRNNFERH 196
            :.||:.|                        :.||...:.||.|.....:....:....:.....
Zfish   167 LYAPFIKWETIESCTRGELGHSLMHQNAVKTQALKPAHTHVPWITINGKYTSELEDKAMSTLFNL 231

  Fly   197 FCRQYLKKFNIKLPTCSAIL 216
            .|..|.   .||.|.|:..|
Zfish   232 VCSLYK---GIKPPVCTGAL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 33..127 CDD:308710 29/96 (30%)
si:dkey-197i20.6XP_693944.2 SapA <33..54 CDD:295328 1/20 (5%)
GILT 68..168 CDD:281251 33/128 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590651
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.