DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and ifi30

DIOPT Version :9

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001017196.1 Gene:ifi30 / 549950 XenbaseID:XB-GENE-1002315 Length:256 Species:Xenopus tropicalis


Alignment Length:190 Identity:50/190 - (26%)
Similarity:80/190 - (42%) Gaps:45/190 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ESRLLVAIHYEALCPDSMSFIRRRLYDALQDNDWW----SVTDLKLYPFGKAGFYNNTSTGESQV 88
            |..:.:.:.||:||.....|:.|:|:.:      |    .:.::.|.|:|.|  .....||:...
 Frog    56 EPAIQIDLFYESLCGGCRGFLVRQLFPS------WLMLAEIINVTLVPYGNA--QETNITGKWVF 112

  Fly    89 FCQHGVDECELNALHACIIETL-DIRKAFNLIYCM-------------LRSYSNELGPCSRSMGV 139
            .||||.:||..|.:.||:|..| ||.|.|.:|:||             |..|:.||         
 Frog   113 DCQHGPEECLGNMMEACLIHILDDIYKYFPIIFCMESSNNVTKSLESCLAVYAPEL--------- 168

  Fly   140 DVSKARECKASRTTAEILAPYGKETLKLGIS----FVPTIVFE----NDFDPYDQRSIRN 191
            .:....||.......:::....::|  .|:|    :||.||.:    :|.....|.|:.|
 Frog   169 PLKTVLECVNGDLGNKLMHENAQKT--KGLSPPHNYVPWIVIDGMHTDDLQAQAQSSLFN 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 33..127 CDD:308710 33/111 (30%)
ifi30NP_001017196.1 GILT 60..161 CDD:281251 32/108 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.