DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and CG9427

DIOPT Version :9

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_649919.1 Gene:CG9427 / 41164 FlyBaseID:FBgn0037721 Length:213 Species:Drosophila melanogaster


Alignment Length:217 Identity:63/217 - (29%)
Similarity:96/217 - (44%) Gaps:24/217 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFTLCLLLVWPTPGNGQSPDESR----LLVAIHYEALCPDSMSFIRR--RLYDALQDNDWWSVTD 66
            |..|.|.|.|..  ..:.|.|.|    |.:.:.||:|||||.:|:.:  .:|:...|     ..|
  Fly    10 LLLLVLSLGWAK--LEEKPREKRQSNKLHITLLYESLCPDSRNFMHQLGPVYEEFGD-----YID 67

  Fly    67 LKLYPFGKAGFYNNTSTGESQVF-CQHGVDECELNALHACII-ETLDIRKAFNLIYC-MLRSYSN 128
            :.|.||||     :.|.....:| ||||..||:.|.|.:|:| .|.:.......:.| ||....:
  Fly    68 ILLVPFGK-----SQSERNGAIFHCQHGPAECKGNRLQSCVINSTANQAAQVKFVVCQMLAPDYS 127

  Fly   129 ELGPCSRSMGVDVSKARECKASRTTAEILAPYGKETLKLGISFVPTIVFENDFDPYDQRSIRNNF 193
            .:..|:...|: ::....|.:|.|..::.......|.:...||:||||:...||...|.....:|
  Fly   128 RIDQCANEAGL-LTDVVHCLSSETGTKLQLQAELVTKQYSPSFIPTIVYNGVFDQQLQDHSLRDF 191

  Fly   194 ERHFCRQYLKKFNIKLPTCSAI 215
            ....|  |:.:....||:.|.|
  Fly   192 RGTVC--YMLRQQNLLPSSSTI 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 33..127 CDD:308710 32/98 (33%)
CG9427NP_649919.1 GILT 36..136 CDD:281251 33/109 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D159048at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
54.920

Return to query results.
Submit another query.