DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and F37H8.5

DIOPT Version :9

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_496397.1 Gene:F37H8.5 / 3564874 WormBaseID:WBGene00009514 Length:277 Species:Caenorhabditis elegans


Alignment Length:207 Identity:46/207 - (22%)
Similarity:86/207 - (41%) Gaps:37/207 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RLLVAIHYEALCPDSMSFIRRRLYDALQDNDWWSVTDLKLYPFGKAGFYNNTSTGESQVFCQHGV 94
            ::.:.:..||||||..:|:.::||..:..| :.:..:::|.|||.|....     :..:.||||.
 Worm    75 KINITVLIEALCPDCQNFLTKQLYPIVFKN-FANYVNIELVPFGNAKVLE-----DGTIKCQHGE 133

  Fly    95 DECELNALHACIIETLDIRKAFNLIYCMLRS------YSNELGPCSRSM--GVDVSK-AREC--- 147
            :||.:|....|.|:::..:.....:.|:..|      :::.:..|...:  |.|:.: .:.|   
 Worm   134 EECSINKFEGCFIDSMQDQSPLPTLSCIEESLQKKVEFADAVQQCFEKLQIGGDIQRLTQSCLVS 198

  Fly   148 --------KASRTTAEILAPYGKETLKLGISFVPTIVFENDFDPYDQRSIRNNFERHFCRQYLKK 204
                    ||:..||.:.....|        |||.::. |.......:..:|......|..|  .
 Worm   199 KLGADLQNKAAAATANVWPEQHK--------FVPWVII-NGVSLTSFQGFQNQLPTLLCEWY--S 252

  Fly   205 FNIKLPTCSAIL 216
            .:..:|.|.|.|
 Worm   253 GDKAIPYCEAAL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 33..127 CDD:308710 26/99 (26%)
F37H8.5NP_496397.1 GILT 77..182 CDD:281251 27/110 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I5954
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57849
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.