DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and W04A4.3

DIOPT Version :9

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_493398.1 Gene:W04A4.3 / 189179 WormBaseID:WBGene00012232 Length:149 Species:Caenorhabditis elegans


Alignment Length:116 Identity:25/116 - (21%)
Similarity:44/116 - (37%) Gaps:38/116 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLFTLCLLLVWPTPGNGQSPDESRLLVAIHYEALCPDSMSFIRRRLYDALQDNDWWSVTDLKLYP 71
            :::::.|::...||           :..||.:.:  |...|.:..|     ...|:..   :|.|
 Worm    14 MIYSVILIITIFTP-----------VQQIHVDII--DITGFAKCAL-----TTKWFRT---QLAP 57

  Fly    72 F-----GKAG------FYNNTSTGESQ------VFCQHGVDECELNALHAC 105
            |     .|.|      .|:..|.|:.:      ..|::|..||:||.|..|
 Worm    58 FLGNLTAKKGPKNLKMVYHPLSIGQKKGNGTAVATCENGWLECQLNKLQCC 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 33..127 CDD:308710 22/90 (24%)
W04A4.3NP_493398.1 GILT 36..142 CDD:281251 20/83 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164068
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.