DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and C02D5.2

DIOPT Version :9

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001040839.1 Gene:C02D5.2 / 176203 WormBaseID:WBGene00015336 Length:323 Species:Caenorhabditis elegans


Alignment Length:243 Identity:64/243 - (26%)
Similarity:102/243 - (41%) Gaps:53/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IFGLLFTLCLLLVWPT---------------------PGNG---QSPDESRLLVAIHYEALCPDS 44
            |:|.:|.|.:.|::.:                     |..|   :.|.|:.:.:.::.||.|||:
 Worm    88 IYGTIFILSIFLLYRSLNSPDTSKHGIGRNGDFIEYEPKAGPTIKEPVENIVKLDVYMEAQCPDT 152

  Fly    45 MSFIRRRLYDALQDNDWWSV------TDLKLYPFGKAGFYNNTSTGESQVFCQHGVDECELNALH 103
            ..|.|::|..|      |.:      .:|.:.|||||......:..|.|  ||||..||::|.|.
 Worm   153 SRFFRQQLKKA------WDILGRLNRIELNVIPFGKARCTEKGNDFECQ--CQHGPTECQINQLM 209

  Fly   104 ACIIETLDI-RKAFNLIYCMLRSYS-NELGPC-SRSMGVDVSKARECKASRTTAEILAPYGKETL 165
            .|:|:.... .:....:.||...|| :|...| :.:...:..:.|||.:......:||..|::|.
 Worm   210 NCVIDRFGFPHRYLPGVLCMQGKYSLDEAMKCVTENYPSEYERMRECASGTRGRRLLALSGQKTA 274

  Fly   166 KL--GISFVPTIVF---ENDFDPYDQRSIRNNFER-----HFCRQYLK 203
            .|  .|.|:|.||.   .|....||  ..:|..|.     ..|:.||:
 Worm   275 SLTPAIDFIPWIVINGSRNSDALYD--LTQNVCEAMQPMPSACKDYLR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 33..127 CDD:308710 30/100 (30%)
C02D5.2NP_001040839.1 GILT 140..246 CDD:281251 34/113 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.