DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GILT3 and pqn-48

DIOPT Version :9

Sequence 1:NP_651165.1 Gene:GILT3 / 42787 FlyBaseID:FBgn0039098 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_494711.1 Gene:pqn-48 / 173743 WormBaseID:WBGene00004135 Length:319 Species:Caenorhabditis elegans


Alignment Length:185 Identity:48/185 - (25%)
Similarity:76/185 - (41%) Gaps:27/185 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VAIHYEALCPDSMSFIRRRLYDALQDNDWWSVTDLKLYPFGKAGFYNNTSTGESQVFCQHGVDEC 97
            :.:.||||||....||..:|....  |.:.....|:|.|:|     |:....:....|.||..||
 Worm   143 ITLIYEALCPYCQKFIANQLGSVF--NQFQGQLILELVPWG-----NSRIMRDGSFSCNHGQKEC 200

  Fly    98 ELNALHACIIETLDIRKAFNLIYCMLRS---YSNE--LGPCSRSMGVDVSKARECKASRTTAEIL 157
            :.|.|.:|:|:.|.::.|...|.|..|:   |..|  :..||..:.....:.|:|.......::.
 Worm   201 DANRLQSCVIDILKVKGALPFIVCFERNIQHYGVEHAMQTCSAFIRSQYRQIRQCYDGPRGVQLQ 265

  Fly   158 APYGKETLKLGISFVPTIVFE------NDFDPYDQRSI-RNNFERHFCRQYLKKF 205
            ....::|:    |..|..:.|      ||:.|    |: .||.......|.|.|:
 Worm   266 REAAQKTM----STRPNPILEVPYLLINDYTP----SVDMNNLNVMLLPQLLAKW 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GILT3NP_651165.1 GILT 33..127 CDD:308710 29/96 (30%)
pqn-48NP_494711.1 GILT 142..242 CDD:281251 31/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D477702at33208
OrthoFinder 1 1.000 - - FOG0000773
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13234
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X814
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.