DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31145 and FAM20B

DIOPT Version :9

Sequence 1:NP_001356923.1 Gene:CG31145 / 42784 FlyBaseID:FBgn0051145 Length:982 Species:Drosophila melanogaster
Sequence 2:XP_016858490.1 Gene:FAM20B / 9917 HGNCID:23017 Length:432 Species:Homo sapiens


Alignment Length:359 Identity:141/359 - (39%)
Similarity:196/359 - (54%) Gaps:49/359 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   636 ITKKELYGEQDTLVDAVLRDMIKLPIQHVVQKEGGTQLKLIIEYPNDIKALMKPMRFPREQQTLP 700
            :..:|:|.|:...:.||:..|....|........|||||.::......|.:.||.||      |.
Human    71 VVPREVYPEETPELGAVMHAMATKKIIKADVGYKGTQLKALLILEGGQKVVFKPKRF------LC 129

  Fly   701 NHFY---------------------------FTDYERHNAEIAAFHLDRILGFRRAMPVAGRTLN 738
            .|.:                           :..|:|||||:|||||||||||.||..|.||.:|
Human   130 GHKFSTHLDRYQKHNCWTTWYSRDHVVEGEPYAGYDRHNAEVAAFHLDRILGFHRAPLVVGRFVN 194

  Fly   739 ITTEIYQLAEENLLKTFFVSPSLNLCFHGKCSYYCDTSHAICGNPDMLEGSFAAFLPNFESGNRK 803
            :.|||..:|.|.||.| |::...|.||:||| |||..:...|.:.|::|||...:||:       
Human   195 LRTEIKPVATEQLLST-FLTVGNNTCFYGKC-YYCRETEPACADGDIMEGSVTLWLPD------- 250

  Fly   804 LW-----RHPWRRSYHKRKKAQWETDANYCALVRDIPPYDDGRRLYDLMDMAVFDFLTGNMDRHH 863
            :|     ||||.|:|.:.|.|:||.|.:||..|:...|||.|.||.|::|.||||:|.||.||||
Human   251 VWPLQKHRHPWGRTYREGKLARWEYDESYCDAVKKTSPYDSGPRLLDIIDTAVFDYLIGNADRHH 315

  Fly   864 YETFKVYGNETFPLHLDHGRGFGRPFHDELSILAPVLQCCLIRKSTLVKLLDFHNGPKPLSQLMS 928
            ||:|:.....:..:.||:.:.||.|..||.|||||:.|||:||.||..:|....||  .|...:.
Human   316 YESFQDDEGASMLILLDNAKSFGNPSLDERSILAPLYQCCIIRVSTWNRLNYLKNG--VLKSALK 378

  Fly   929 ESLSQDPVSPVLWQPHLEALDRRTGIILQSIRDC 962
            .:::.||:||||..|||:|:|:|...:|.:::.|
Human   379 SAMAHDPISPVLSDPHLDAVDQRLLSVLATVKQC 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31145NP_001356923.1 Fam20C 755..971 CDD:336477 91/213 (43%)
FAM20BXP_016858490.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D227822at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4404
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.