DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31145 and Samd7

DIOPT Version :9

Sequence 1:NP_001356923.1 Gene:CG31145 / 42784 FlyBaseID:FBgn0051145 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_083765.2 Gene:Samd7 / 75953 MGIID:1923203 Length:445 Species:Mus musculus


Alignment Length:225 Identity:45/225 - (20%)
Similarity:73/225 - (32%) Gaps:70/225 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   413 RLRSFGSINRKHQETAAPPKGGQQKAISAASNNSCNTNPIMAVLRTMKLKERLVISLGATLVLLT 477
            |||. |::.:|      ||:...:...|.|...|.:..|.::......:|:              
Mouse   186 RLRR-GAVYQK------PPESDTESFKSQAEEKSSSQMPTLSYEEEEYIKD-------------- 229

  Fly   478 LLLIVDVQMDFGVANRHLLQQQHQKIRLGNDYDGGTGGGGMLHEFKRKFLQKSNASGSKEASTQA 542
                .|:::|         .||..::..|..........|.||..:|           |.:|.:|
Mouse   230 ----PDIEVD---------NQQKPRVADGKPTTVPANPHGELHTHQR-----------KPSSLEA 270

  Fly   543 GASQSGGATSGQDAAAGASG--GAAGP-------GTSRSTSTRKPTPHDRYADLQKHLLSD---- 594
            .|...|.....:....|..|  |...|       ||....:.|:   :...:|:||..:.|    
Mouse   271 NAWDDGKGKPSEQVYEGCDGKNGVFRPVSILPLSGTHEQVALRE---NCSLSDIQKWTVDDVYNF 332

  Fly   595 --------EYSHVIVDNAPDVSRDNPTLAE 616
                    :|:.|..|:|.| ....|.|.|
Mouse   333 IRSLPGCSDYAQVFKDHAID-GETLPLLTE 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31145NP_001356923.1 Fam20C 755..971 CDD:336477
Samd7NP_083765.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 193..282 22/132 (17%)
SAM_Samd7,11 321..388 CDD:188978 11/42 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..445
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.