DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31145 and samd7

DIOPT Version :9

Sequence 1:NP_001356923.1 Gene:CG31145 / 42784 FlyBaseID:FBgn0051145 Length:982 Species:Drosophila melanogaster
Sequence 2:XP_005171361.1 Gene:samd7 / 563729 ZFINID:ZDB-GENE-070912-549 Length:527 Species:Danio rerio


Alignment Length:533 Identity:95/533 - (17%)
Similarity:171/533 - (32%) Gaps:157/533 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 RYRQQLQLQQEPHQQQQQQQQQQQQQQSTADIDVYDSPFNGQLSAERIGVANWRRGNVEGPIGGR 328
            |.||:|.::.:.....|...|.||:.|.                                     
Zfish    38 RQRQELMMRNQMAMAPQILAQGQQRLQG------------------------------------- 65

  Fly   329 APVEAEYS---AEQEELPPDRVLYPDSEPEE------EEAAPRRRVVIRRRIVRTS----RTASQ 380
              |.|::.   .|:|.:||..::..|:....      ::..|...|:..|....|.    :|.|.
Zfish    66 --VPAQFDPRFMERELVPPADMVSADARQIHMGAHLGQQLPPNSNVIPGRGYPGTGYNFLQTESM 128

  Fly   381 DPQTQTAEVVPKSSNDSSTPAEINGRNLGWLTRLRSFGSINRKHQETAAPPKGGQQKAISAASN- 444
            :...:..|::.|.:                :.|:.....:::|..|.|      .||.:.:..| 
Zfish   129 ETVARRQELIHKQN----------------IARMEMNAILHQKELENA------HQKGLISIENP 171

  Fly   445 ---NSCNTNPIMAVLRTMKLKERLVISLGATLVLLTLLLIVDVQMDFGVANRHLLQQQHQKI-RL 505
               .....|| ||.....:|.:...:.:..|       .:.|:.     ||..|:...:..| .|
Zfish   172 MMYQGIQPNP-MAFRGRQRLPDGHDVFVHRT-------ALEDLH-----ANSLLMSSPYPPISTL 223

  Fly   506 GNDYDGGTGGGGMLHEFKRKFLQKSNASGSKEASTQAGASQSGGATSGQDAAAGASGGAAGPGTS 570
            ..:....||.....|:     ...||.:..|..|.:....||.||.||::..|...|       |
Zfish   224 QRERGRRTGRRTTNHK-----SSDSNITLPKGQSEEKNIEQSPGAASGEEKEAEGKG-------S 276

  Fly   571 RSTSTRKPTPHDRYADLQKHLLSDEYSHVIVDNAPDVSRDNPTLAEMLHRKASANASNLERFQLR 635
            .:||::   ||...|:.:  |.|........:..|.:.:...:..|.....::.|||.       
Zfish   277 DATSSK---PHQTKAETE--LSSGGSRKGFKEGEPGIRKACISGQEGCAEVSNCNAST------- 329

  Fly   636 ITKKELYGEQDTLVDAVLRDMIKLPIQHVVQKEGGTQLKLIIEYPNDIKALMKPMRFPREQQTLP 700
             :.|::........|..|......|:         |.:..::..|.:....:.|          |
Zfish   330 -SDKDMSNPCSAFQDKFLYPSTSGPL---------TGMPYMLPVPGNGLLPLGP----------P 374

  Fly   701 NHFYFTDYERHNAEIAAFHLDRILGFRRAMP-------------VAGRTLNITTEIYQLAEENLL 752
            |.|...:....:.:|..:.:|.:..|...:|             :.|.||.:      |.|::||
Zfish   375 NMFLNGEEMSSSEDIRKWTVDDVYSFISEIPSCAEYAQTFKEHMIDGETLPL------LTEDHLL 433

  Fly   753 KT--FFVSPSLNL 763
            .|  ..:.|:|.:
Zfish   434 DTLGLKLGPALKI 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31145NP_001356923.1 Fam20C 755..971 CDD:336477 2/9 (22%)
samd7XP_005171361.1 SAM_Samd7,11 389..456 CDD:188978 14/64 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.