DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31145 and fam20b

DIOPT Version :9

Sequence 1:NP_001356923.1 Gene:CG31145 / 42784 FlyBaseID:FBgn0051145 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_989211.1 Gene:fam20b / 394819 XenbaseID:XB-GENE-1005213 Length:409 Species:Xenopus tropicalis


Alignment Length:330 Identity:140/330 - (42%)
Similarity:193/330 - (58%) Gaps:12/330 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   636 ITKKELYGEQDTLVDAVLRDMIKLPIQHVVQKEGGTQLKLIIEYPNDIKALMKPMRFPREQ--QT 698
            :..:|:|.|....:.|||..|....|........|||||.::......|.:.||.|:.|:.  :.
 Frog    71 VVPREVYPEDSPEMGAVLHSMATKKIVKADVGYKGTQLKALLVLEGGQKVVFKPKRYSRDYIVEG 135

  Fly   699 LPNHFYFTDYERHNAEIAAFHLDRILGFRRAMPVAGRTLNITTEIYQLAEENLLKTFFVSPSLNL 763
            .|    :..|:|||||:.|||||||||||||..|.||.:|:.|||..:|.|.||.| |:....|.
 Frog   136 EP----YAGYDRHNAEVTAFHLDRILGFRRAPLVVGRYVNLITEIKPVATEQLLST-FLKQGNNT 195

  Fly   764 CFHGKCSYYCDTSHAICGNPDMLEGSFAAFLPNFESGNRKLWRHPWRRSYHKRKKAQWETDANYC 828
            ||:||| |||..:...|...:::||:...:||  |:...:..||||.|:|.:.|.|:||.|.:||
 Frog   196 CFYGKC-YYCRETEPACAERELMEGTVTLWLP--EAWPLQKHRHPWGRTYREGKLARWEYDESYC 257

  Fly   829 ALVRDIPPYDDGRRLYDLMDMAVFDFLTGNMDRHHYETFKVYGNETFPLHLDHGRGFGRPFHDEL 893
            ..|:...|||.|.||.|::|.|:||||.||.||||||:|:.....:..:.||:.:.||.|..||.
 Frog   258 DAVKKTSPYDSGPRLLDVIDTAIFDFLIGNADRHHYESFQDDEGGSMLILLDNAKSFGNPLVDER 322

  Fly   894 SILAPVLQCCLIRKSTLVKLLDFHNGPKPLSQLMSESLSQDPVSPVLWQPHLEALDRRTGIILQS 958
            |||||:.|||:||.||..:|....:|  .|...:..:.:.||:||||...||:||:||...||.:
 Frog   323 SILAPLYQCCIIRVSTWNRLSHLKHG--TLRSALLTATAHDPISPVLSDAHLDALERRLQSILAT 385

  Fly   959 IRDCI 963
            ::.||
 Frog   386 VQQCI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31145NP_001356923.1 Fam20C 755..971 CDD:336477 90/209 (43%)
fam20bNP_989211.1 FAM20B_C 188..394 CDD:198461 90/208 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D227822at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.