DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31145 and Fam20b

DIOPT Version :9

Sequence 1:NP_001356923.1 Gene:CG31145 / 42784 FlyBaseID:FBgn0051145 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_001100657.1 Gene:Fam20b / 304885 RGDID:1311162 Length:409 Species:Rattus norvegicus


Alignment Length:334 Identity:140/334 - (41%)
Similarity:197/334 - (58%) Gaps:22/334 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   636 ITKKELYGEQDTLVDAVLRDMIKLPIQHVVQKEGGTQLKLIIEYPNDIKALMKPMRFPREQ--QT 698
            :..:|:|.|:...:.||:..|....|........|||||.::......|.:.||.|:.|:.  :.
  Rat    71 VVPREVYPEETPELGAVMHAMATKKIIKADVGYKGTQLKALLTLEGGQKVVFKPKRYSRDYVVEG 135

  Fly   699 LPNHFYFTDYERHNAEIAAFHLDRILGFRRAMPVAGRTLNITTEIYQLAEENLLKTFFVSPSLNL 763
            .|    :..|:|||||:||||||||||||||..|.||.:|:.||:..:|.|.||.| |::...|.
  Rat   136 EP----YAGYDRHNAEVAAFHLDRILGFRRAPLVVGRYVNLRTEVKPVATEQLLST-FLTVGNNT 195

  Fly   764 CFHGKCSYYCDTSHAICGNPDMLEGSFAAFLPNFESGNRKLW-----RHPWRRSYHKRKKAQWET 823
            ||:||| |||..:...|.:.||:|||...:||:       :|     ||||.|:|.:.|.|:||.
  Rat   196 CFYGKC-YYCRETEPACADGDMMEGSITLWLPD-------VWPLQKHRHPWGRTYREGKLARWEY 252

  Fly   824 DANYCALVRDIPPYDDGRRLYDLMDMAVFDFLTGNMDRHHYETFKVYGNETFPLHLDHGRGFGRP 888
            |.:||..|:...|||.|.||.|::|.||||:|.||.||||||:|:.....:..:.||:.:.||.|
  Rat   253 DESYCDAVKKTSPYDSGPRLLDIIDTAVFDYLIGNADRHHYESFQDDEGASMLILLDNAKSFGNP 317

  Fly   889 FHDELSILAPVLQCCLIRKSTLVKLLDFHNGPKPLSQLMSESLSQDPVSPVLWQPHLEALDRRTG 953
            ..||.|||||:.|||:||.||..:|....||  .|...:..:::.||::|||..|||:.:|:|..
  Rat   318 SLDERSILAPLYQCCIIRVSTWNRLNYLKNG--VLKSALKSAMAHDPIAPVLSDPHLDTVDQRLL 380

  Fly   954 IILQSIRDC 962
            .:|.:|:.|
  Rat   381 NVLATIKQC 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31145NP_001356923.1 Fam20C 755..971 CDD:336477 91/213 (43%)
Fam20bNP_001100657.1 FAM20B_C 188..394 CDD:198461 91/212 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D227822at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.