DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31145 and RGD1559578

DIOPT Version :9

Sequence 1:NP_001356923.1 Gene:CG31145 / 42784 FlyBaseID:FBgn0051145 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_001127969.1 Gene:RGD1559578 / 287783 RGDID:1559578 Length:268 Species:Rattus norvegicus


Alignment Length:167 Identity:37/167 - (22%)
Similarity:64/167 - (38%) Gaps:18/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 QLQLQQEPHQQQQQQQQQQQQQQSTADIDVYDSPFNGQLSAERIGVANWRRGNVEGPIGGRAPVE 332
            |:.....||...:...:::::.:...::.......:||...::.||  |..|:.....|.....|
  Rat    11 QMSQSVTPHDSIRVSHERKKENKKHEELPEGHHSAHGQTPQDKEGV--WSPGSKTKEAGEDGAEE 73

  Fly   333 AEYSAEQEELPPDRVLYPDSEPEEE--EAAPRRRVVIRRRIVRTSRTASQDPQTQTAEVVP-KSS 394
            ......:|||..|.....|::..|:  |.:|...:..|:  ...|..:|..| .||.::.| |.:
  Rat    74 EGPFPSKEELQKDMQGASDTKAAEQGCELSPLTTMSFRK--YDPSPLSSPYP-LQTEKISPHKRA 135

  Fly   395 NDSSTPAEINGRNL----------GWLTRLRSFGSIN 421
            .....|.:...|:|          ||..|...||.||
  Rat   136 RMVRLPQQGPFRHLMDMKTEKRLAGWKERRSRFGDIN 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31145NP_001356923.1 Fam20C 755..971 CDD:336477
RGD1559578NP_001127969.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.