DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31145 and Fam20b

DIOPT Version :9

Sequence 1:NP_001356923.1 Gene:CG31145 / 42784 FlyBaseID:FBgn0051145 Length:982 Species:Drosophila melanogaster
Sequence 2:NP_663388.1 Gene:Fam20b / 215015 MGIID:2443990 Length:409 Species:Mus musculus


Alignment Length:352 Identity:143/352 - (40%)
Similarity:201/352 - (57%) Gaps:36/352 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   636 ITKKELYGEQDTLVDAVLRDMIKLPIQHVVQKEGGTQLKLIIEYPNDIKALMKPMRFPREQQTLP 700
            :..:|:|.|:...:.|::..|....|........|||||.::......|.:.||.|:.|:     
Mouse    71 VVPREVYPEETPELGAIMHAMATKKIIKADVGYKGTQLKALLILEGGQKVVFKPKRYSRD----- 130

  Fly   701 NHFY------FTDYERHNAEIAAFHLDRILGFRRAMPVAGRTLNITTEIYQLAEENLLKTFFVSP 759
               |      :..|:|||||:||||||||||||||..|.||.:|:.||:..:|.|.||.| |::.
Mouse   131 ---YVVEGEPYAGYDRHNAEVAAFHLDRILGFRRAPLVVGRYVNLRTEVKPVATEQLLST-FLTV 191

  Fly   760 SLNLCFHGKCSYYCDTSHAICGNPDMLEGSFAAFLPNFESGNRKLW-----RHPWRRSYHKRKKA 819
            ..|.||:||| |||..:...|.:.||:|||...:||:       :|     ||||.|:|.:.|.|
Mouse   192 GNNTCFYGKC-YYCRETEPACADGDMMEGSVTLWLPD-------VWPLQKHRHPWGRTYREGKLA 248

  Fly   820 QWETDANYCALVRDIPPYDDGRRLYDLMDMAVFDFLTGNMDRHHYETFKVYGNETFPLHLDHGRG 884
            :||.|.:||..|:...|||.|.||.|::|.||||:|.||.||||||:|:.....:..:.||:.:.
Mouse   249 RWEYDESYCDAVKKTSPYDSGPRLLDIIDTAVFDYLIGNADRHHYESFQDDEGASMLILLDNAKS 313

  Fly   885 FGRPFHDELSILAPVLQCCLIRKSTLVKLLDFHNGPKPLSQLMSESLSQDPVSPVLWQPHLEALD 949
            ||.|..||.|||||:.|||:||.||..:|....||  .|...:..:::.||:||||..|||:.:|
Mouse   314 FGNPSLDERSILAPLYQCCIIRVSTWNRLNYLKNG--VLKSALKSAMAHDPISPVLSDPHLDTVD 376

  Fly   950 RRTGIILQSIRDCIKRNPPGDVDGSET 976
            :|...:|.:|:.|.      |..|::|
Mouse   377 QRLLNVLATIKQCT------DQFGTDT 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31145NP_001356923.1 Fam20C 755..971 CDD:336477 92/220 (42%)
Fam20bNP_663388.1 FAM20B_C 188..394 CDD:198461 93/221 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3829
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4404
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.