DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31145 and LOC100536075

DIOPT Version :9

Sequence 1:NP_001356923.1 Gene:CG31145 / 42784 FlyBaseID:FBgn0051145 Length:982 Species:Drosophila melanogaster
Sequence 2:XP_003201806.4 Gene:LOC100536075 / 100536075 -ID:- Length:143 Species:Danio rerio


Alignment Length:135 Identity:73/135 - (54%)
Similarity:94/135 - (69%) Gaps:3/135 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   846 LMDMAVFDFLTGNMDRHHYETFKVYGNETFPLHLDHGRGFGRPFHDELSILAPVLQCCLIRKSTL 910
            ::||||||||||||||||||.|..:|:|.|.||||:.|||||..|||||||||:.|||:|::|||
Zfish     1 MIDMAVFDFLTGNMDRHHYEIFTKFGDEGFLLHLDNARGFGRHSHDELSILAPLTQCCMIKRSTL 65

  Fly   911 VKLLDFHNGPKPLSQLMSESLSQDPVSPVLWQPHLEALDRRTGIILQSIRDCIKRNPPGDV---D 972
            .:|....:....||.:|.||||:|.:||||.:.||:|||||....|.::..|:.::....|   |
Zfish    66 FRLKLLSSSEYLLSDVMRESLSRDALSPVLTEEHLQALDRRLKHTLLAVDTCVDKHGEAQVVFTD 130

  Fly   973 GSETD 977
            ..|.|
Zfish   131 FEEAD 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31145NP_001356923.1 Fam20C 755..971 CDD:336477 69/124 (56%)
LOC100536075XP_003201806.4 FAM20_C_like <1..127 CDD:323276 69/125 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581822
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D227822at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.