DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IV and beat-IIa

DIOPT Version :9

Sequence 1:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001287375.1 Gene:beat-IIa / 42086 FlyBaseID:FBgn0038498 Length:431 Species:Drosophila melanogaster


Alignment Length:193 Identity:57/193 - (29%)
Similarity:97/193 - (50%) Gaps:20/193 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 EGEALYAIKWYKDNEEFYRYVPKARPPKTSYRVDGVRVIEELSDASRVLLRGLTLNSTGLYRCEV 271
            :|..||:.|:|:...|||||.|...|....:...|:.|....|:|::||||.:....:|.:.|||
  Fly    95 DGAPLYSAKFYRGQLEFYRYTPGEFPNTKVFPFPGIHVDVSSSNATQVLLRNVGFGLSGNFSCEV 159

  Fly   272 SAEAPNFSSVQGEGRMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVNEQPI 336
            :|:||.||:......|.:|.||...|.:..:..:|:.|:.|..||::..|.|.:.|.:.:|...|
  Fly   160 TADAPLFSTATAVDTMQVVELPEKRPQVFTEHTRYEPGDVLRANCSTPPSRPRAELTFTINNMVI 224

  Fly   337 --LDEHYLHKYNDIVHKHGLITSTLGLQLPLEPRHFHEGDMRVKCLASISPVLWKG--GKESV 395
              :|..|:...::      ||.:.:.|::.|:..||          :|::|.::..  |..||
  Fly   225 THVDTEYIRTIDN------LIATRISLKMQLQGIHF----------SSVNPAIYNNVYGLNSV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 27/72 (38%)
Ig 314..>362 CDD:299845 11/49 (22%)
beat-IIaNP_001287375.1 PTZ00491 <209..>261 CDD:240439 15/67 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.