DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IV and beat-Vb

DIOPT Version :9

Sequence 1:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001262511.1 Gene:beat-Vb / 41583 FlyBaseID:FBgn0038092 Length:328 Species:Drosophila melanogaster


Alignment Length:262 Identity:72/262 - (27%)
Similarity:126/262 - (48%) Gaps:42/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 GEALYAIKWYKDNEEFYRYVPKARPPKTSYRVDGVRVIE---ELSDAS-RVLLRGLTLNSTGLYR 268
            |..|.::||||:.:||:||.|...|....:.|:||::|:   |.:::| ||.|..|.:.|:|:||
  Fly    51 GHTLNSVKWYKNGKEFFRYSPLTPPTYIPFAVEGVQLIDDGNECNESSCRVELNLLGVKSSGVYR 115

  Fly   269 CEVSAEAPNFSSVQGEGRMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVNE 333
            ||||.:||:|.....:..|.:..||::.|.|......|:..:::.:||::..|...:.:.|:||.
  Fly   116 CEVSGDAPHFQLTARDANMTVEALPQNNPLISSFHSTYRFNDFVEVNCSTDFSSLFTRITWYVNG 180

  Fly   334 QPILDEHYLHKYNDIVHKHGLITSTLGLQLPL---EPRHFHEGDMR-----------------VK 378
            ..:.....|..:...:..||.....:..||..   ||| ||:..::                 ::
  Fly   181 IKVSLVDLLPSFETTIVAHGYSMRRIVSQLNFYANEPR-FHQLQLQKLIQQKRTISPARLGLELR 244

  Fly   379 CLASIS--PVLWKGG-------KESVLQRRPGIIDNREAMLLVKGAAGHSESSFLRTLTIAIILA 434
            |:|.|.  |.|.:.|       ::.:.|:...:|::|      .||..:|:...|  |.:||.:.
  Fly   245 CVAEIDRYPHLQREGTMFAQLFRDDIDQKNQKLINSR------SGATPNSQVQHL--LLVAISMT 301

  Fly   435 RT 436
            .|
  Fly   302 MT 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 31/76 (41%)
Ig 314..>362 CDD:299845 9/47 (19%)
beat-VbNP_001262511.1 IG_like 39..121 CDD:214653 30/69 (43%)
Ig 41..130 CDD:143165 33/78 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.