DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IV and beat-Va

DIOPT Version :9

Sequence 1:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001189214.1 Gene:beat-Va / 41578 FlyBaseID:FBgn0038087 Length:300 Species:Drosophila melanogaster


Alignment Length:244 Identity:80/244 - (32%)
Similarity:120/244 - (49%) Gaps:22/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 GEALYAIKWYKDNEEFYRYVPKARPPKTSYRVDGVRVIE------ELSDASRVLLRGLTLNSTGL 266
            |..|.::|||||:|||:||.|...|...::.|.|::|:|      |.|....:.|:|  ..||||
  Fly    50 GHTLNSVKWYKDHEEFFRYSPLTSPIYMTFDVAGLQVLEGKYVCNESSCRLDLSLQG--AKSTGL 112

  Fly   267 YRCEVSAEAPNFSSVQGEGRMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFV 331
            |:||||.:||:|........|.:..||::.|.|......|::.|||...|.|..|...:.|.|::
  Fly   113 YKCEVSGDAPHFKLADKADNMTVAALPQNDPLIESFNSMYRMEEYLKATCISDFSSLPTRLTWYI 177

  Fly   332 N-EQPILDEHYLHKYNDI-VHKHGLITSTLGLQLPLEPRHFHEGD--MRVKCLASIS--PVLWKG 390
            | |||:|.|.|......: .|.:.|....|.:|..|:.:.|.:..  :.:||:|.|.  |.|   
  Fly   178 NGEQPLLGELYPTTDTSLAAHDYVLRRQRLQVQFFLQGQRFFQAGKILELKCVAEIENYPEL--- 239

  Fly   391 GKESVLQRRPGIIDNREAMLLVKGA---AGHSESSFL--RTLTIAIILA 434
            .:|..|.......||....:.::.|   :|.::.|.|  ||..|:..||
  Fly   240 RREKTLSASLSQYDNFNNQMPLRHANANSGSAQRSILCGRTSLISAFLA 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 32/78 (41%)
Ig 314..>362 CDD:299845 15/49 (31%)
beat-VaNP_001189214.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.