DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IV and beat-IIIb

DIOPT Version :9

Sequence 1:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_788071.3 Gene:beat-IIIb / 35031 FlyBaseID:FBgn0053179 Length:404 Species:Drosophila melanogaster


Alignment Length:209 Identity:92/209 - (44%)
Similarity:128/209 - (61%) Gaps:7/209 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 EGEALYAIKWYKDNEEFYRYVPKARPPKTSYRVDGVRVIEELSDASRVLLRGLTLNSTGLYRCEV 271
            :||:||::|||||..|||||||:..||...:.:.||.|..:.|....|:||.::|.|||.|||||
  Fly    57 DGESLYSVKWYKDGFEFYRYVPRDMPPGQVFPLPGVDVELQNSTDVVVVLRSVSLQSTGRYRCEV 121

  Fly   272 SAEAPNFSSVQGEGRMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVNEQPI 336
            |.|||:|.:|.|...|.:|..|:.||.|.|.|.:||||:.:.:||||..|.|..||.|.:|... 
  Fly   122 SGEAPSFQTVSGHEDMIVVVTPKHGPQITGGQPRYQIGDMVRVNCTSAASRPVCHLSWLINGMH- 185

  Fly   337 LDEHYLHKYND-IVHKHGLITSTLGLQLPLEPRHFHEGDMRVKCLASISPVLWKGGKESV----L 396
            .:...|..|.. ||.:.||..:.|||:..:.. ||..|||::||:|.||.|.|:..:|||    .
  Fly   186 ANRSLLRPYEPLIVGREGLEVARLGLEFRVRGXHFKHGDMKLKCVAKISSVYWQSNEESVESDKH 250

  Fly   397 QRRPGIIDNREAML 410
            ||.| ::::||.::
  Fly   251 QRIP-VLESRETVM 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 38/72 (53%)
Ig 314..>362 CDD:299845 18/48 (38%)
beat-IIIbNP_788071.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113977at6656
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.