DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IV and beat-Ib

DIOPT Version :9

Sequence 1:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001162987.1 Gene:beat-Ib / 34939 FlyBaseID:FBgn0028645 Length:327 Species:Drosophila melanogaster


Alignment Length:201 Identity:65/201 - (32%)
Similarity:112/201 - (55%) Gaps:7/201 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 EGEALYAIKWYKDNEEFYRYVPKARPP-KTSYRVDGVRVIEELSDASRVLLRGLTLNSTGLYRCE 270
            |.:.||.:|||:...|||||.||..|. |...:.:.:.|....|:||.||||.:..:.:|.:.||
  Fly    55 ENDTLYTVKWYRGRREFYRYTPKENPAWKIFTKTNEIDVETAQSNASHVLLRNVPTSISGKFACE 119

  Fly   271 VSAEAPNFSSVQGEGRMDIVFLPRDGPHIRGQQYQYQIGEYLYLNCTSGKSHPASHLQWFVNEQP 335
            |||:||.|.:......|::|.||...|.|.|...:|::|:.:..||:|..|.||::|.|::|:..
  Fly   120 VSADAPTFDTSIVAADMEVVELPTQRPIITGIHSRYRLGDVINGNCSSDYSKPAANLTWWINDIQ 184

  Fly   336 ILDEHYLHKYNDIVHKH---GLITSTLGLQLPLEPRHFHEGDMRVKCLASISPVLWKGGKESVLQ 397
            : ..:||..|:  :.:|   .|.::.|.::..:...||.:..:::||.|.|..:..:..::.:.:
  Fly   185 V-PPNYLRIYD--IQRHVAEHLESAVLEIKFVVTVHHFIKSRLKLKCSARIHEIYAQESEKLIEE 246

  Fly   398 RRPGII 403
            .||.|:
  Fly   247 DRPRIL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 30/73 (41%)
Ig 314..>362 CDD:299845 15/50 (30%)
beat-IbNP_001162987.1 Ig 160..>182 CDD:299845 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000798
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21261
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.