DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beat-IV and CADM2

DIOPT Version :9

Sequence 1:NP_001262876.1 Gene:beat-IV / 42778 FlyBaseID:FBgn0039089 Length:446 Species:Drosophila melanogaster
Sequence 2:XP_016861551.1 Gene:CADM2 / 253559 HGNCID:29849 Length:449 Species:Homo sapiens


Alignment Length:127 Identity:34/127 - (26%)
Similarity:60/127 - (47%) Gaps:11/127 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 RVDGVRVI-EELSDASRVLLRGLTLNSTGLYRCEVSAEAPNFSSVQGEGRMDIVFLPRDGPHIRG 301
            |::.||.. .|||    :.:..::|:..|.|.|.:.......|    :..:.::.:| :.|.|.|
Human    90 RIELVRASWHELS----ISVSDVSLSDEGQYTCSLFTMPVKTS----KAYLTVLGVP-EKPQISG 145

  Fly   302 QQYQYQIGEYLYLNCTSGKSHPASHLQWFVNEQPILDEHYLHKYNDIVHKHGLITSTLGLQL 363
            .......|:.:.|.|.:..|.||:.::||.|::.|.|..|| |..|...|...::|||..::
Human   146 FSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYL-KEEDANRKTFTVSSTLDFRV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beat-IVNP_001262876.1 Ig <212..285 CDD:299845 11/47 (23%)
Ig 314..>362 CDD:299845 18/47 (38%)
CADM2XP_016861551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.