DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and UGT78D2

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:288 Identity:62/288 - (21%)
Similarity:110/288 - (38%) Gaps:78/288 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SPNGFA---LDNTFLSRWSNWIYITEEKLLERL-VFRPAQVRLFKKFFGYPAEKLD-----ELRA 242
            :|.|..   ||:.|            .|:|.:: :..|....:|...|    |.||     .||:
plant   191 TPEGVVFGNLDSVF------------SKMLHQMGLALPRATAVFINSF----EDLDPTLTNNLRS 239

  Fly   243 RFSVILVNSHFSMGRVRANVPNIIEVAGVHLSEPPEPCGAELQKYLDEAEHGAI-YFSMGQDIL- 305
            ||     ..:.::|.:     .::......|.:.|..|.|    ::::...|:: |.|.|..:. 
plant   240 RF-----KRYLNIGPL-----GLLSSTLQQLVQDPHGCLA----WMEKRSSGSVAYISFGTVMTP 290

  Fly   306 ----IKYLPENMQKQLLLVFLQMKQRVIWKSELSMLANKSENIYVMDKVPQRMVLAHPNLRLFIT 366
                :..:.|.::...:.....:|::.:.:.....|....|...|:...||..:|.|....:|:|
plant   291 PPGELAAIAEGLESSKVPFVWSLKEKSLVQLPKGFLDRTREQGIVVPWAPQVELLKHEATGVFVT 355

  Fly   367 HGGLQSVMEAIDNGVPMLGLPLFFDQFNNIHRVQLA---------------GMAKVLDPNDLNAD 416
            |.|..||:|::..||||:..|.|.||..|...|::.               |..|.||       
plant   356 HCGWNSVLESVSGGVPMICRPFFGDQRLNGRAVEVVWEIGMTIINGVFTKDGFEKCLD------- 413

  Fly   417 TLIETIKELLENPS-----YAQRAKEMA 439
                  |.|:::..     .|::.||:|
plant   414 ------KVLVQDDGKKMKCNAKKLKELA 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 62/288 (22%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 62/288 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.