DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and AT5G17040

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_197206.2 Gene:AT5G17040 / 831567 AraportID:AT5G17040 Length:442 Species:Arabidopsis thaliana


Alignment Length:278 Identity:56/278 - (20%)
Similarity:109/278 - (39%) Gaps:56/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 SPNGFA---LDNTFLSRWSNWIYITEEKLLERL-VFRPAQVRLFKKFFGYPAEKL-----DELRA 242
            :|.|..   ||:.|            .|:|.:: :..|....::...|    |:|     |.||.
plant   172 TPEGVVFGNLDSVF------------SKMLHQMGLALPRATTVYMNSF----EELDPTLTDNLRL 220

  Fly   243 RFSVILVNSHFSMGRVRANVPNIIEVAGVHLSEPPEPCGAELQKYLDEAEHGAIYFSMGQ----- 302
            :|     ..:.|:|.:............:|   .|..|.|.::|   .:....:|.:.|:     
plant   221 KF-----KRYLSIGPLALLFSTSQRETPLH---DPHGCLAWIKK---RSTASVVYIAFGRVMTPP 274

  Fly   303 --DILIKYLPENMQKQLLLVFLQMKQRVIWKSELSMLANKSENIYVMDKVPQRMVLAHPNLRLFI 365
              ::::  :.:.::...:.....::::.:.......|....|...|:...||..:|.|..:.:|:
plant   275 PGELVV--VAQGLESSKVPFVWSLQEKNMVHLPKGFLDGTREQGMVVPWAPQVELLNHEAMGVFV 337

  Fly   366 THGGLQSVMEAIDNGVPMLGLPLFFDQFNNIHRVQLA---GMAKVLDPNDLNADTLIETIKELLE 427
            :|||..||:|::..||||:..|:|.|...|...|:..   ||  .:.......|...|::..:|.
plant   338 SHGGWNSVLESVSAGVPMICRPIFGDHALNARSVEAVWEIGM--TISSGVFTKDGFEESLDRVLV 400

  Fly   428 NPS------YAQRAKEMA 439
            ...      .|::.||:|
plant   401 QDDGKKMKFNAKKLKELA 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 56/278 (20%)
AT5G17040NP_197206.2 Glycosyltransferase_GTB_type 2..428 CDD:299143 56/278 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.