DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and UGT78D3

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:295 Identity:61/295 - (20%)
Similarity:113/295 - (38%) Gaps:73/295 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 AILNNNGVQML--MRDKSIRF----DMIMVEASHLDALYG-LAEFYNATL--LGISCMHMTWHID 172
            ||..|.||:.:  ..:::|.|    :.|.|:.:....::| |...::.||  :|::....|    
plant   156 AIRENVGVKEVGERMEETIGFISGMEKIRVKDTQEGVVFGNLDSVFSKTLHQMGLALPRAT---- 216

  Fly   173 YLAGNLAPSVYEPISPNGFALDNTFLSRWSNWIYITEEKLLERLVFRPAQVRLFKKFFGYPAEKL 237
                .:..:.:|.:.|   ...|.|.|.:..::.|....||.    .|:|.              
plant   217 ----AVFINSFEELDP---TFTNDFRSEFKRYLNIGPLALLS----SPSQT-------------- 256

  Fly   238 DELRARFSVILVNSHFSMGRV-RANVPNIIEVAGVHLSEPPEPCGAELQKYLDEAEHGAIYFSMG 301
                   |.::.:.|..:..: :.:..::..:|...::.||.   .||.......|...:.|...
plant   257 -------STLVHDPHGCLAWIEKRSTASVAYIAFGRVATPPP---VELVAIAQGLESSKVPFVWS 311

  Fly   302 -QDILIKYLPENMQKQLLLVFLQMKQRVIWKSELSMLANKSENIYVMDKVPQRMVLAHPNLRLFI 365
             |::.:.:|||                       ..|....|...|:...||..:|.|..:.:|:
plant   312 LQEMKMTHLPE-----------------------GFLDRTREQGMVVPWAPQVELLNHEAMGVFV 353

  Fly   366 THGGLQSVMEAIDNGVPMLGLPLFFDQFNNIHRVQ 400
            :|||..||:|::..||||:..|:|.|...|...|:
plant   354 SHGGWNSVLESVSAGVPMICRPIFGDHAINARSVE 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 61/295 (21%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 61/295 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.