DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and AT4G36770

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_195395.4 Gene:AT4G36770 / 829830 AraportID:AT4G36770 Length:457 Species:Arabidopsis thaliana


Alignment Length:256 Identity:66/256 - (25%)
Similarity:103/256 - (40%) Gaps:60/256 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 SMGRVRANVPNIIEVAGVHLSEPPEPCGAE--LQKYLD-EAEHGAIYFSMGQDILIKYLPENMQK 315
            ::|||...||  :...| .|..|.|| |.:  :..:|| :.:...:|.|.|....:.:    .|.
plant   225 NLGRVMRGVP--VYPVG-PLVRPAEP-GLKHGVLDWLDLQPKESVVYVSFGSGGALTF----EQT 281

  Fly   316 QLLLVFLQMK-QRVIW------------------KSE---LSMLAN------KSENIYVMDKVPQ 352
            ..|...|::. .|.:|                  |:|   |..|.|      |...:.|....||
plant   282 NELAYGLELTGHRFVWVVRPPAEDDPSASMFDKTKNETEPLDFLPNGFLDRTKDIGLVVRTWAPQ 346

  Fly   353 RMVLAHPNLRLFITHGGLQSVMEAIDNGVPMLGLPLFFDQFNNIHRVQLAGMAKV-LDPNDLNAD 416
            ..:|||.:...|:||.|..||:|:|.|||||:..||:.:|..|...|  :|..|: |..|..:..
plant   347 EEILAHKSTGGFVTHCGWNSVLESIVNGVPMVAWPLYSEQKMNARMV--SGELKIALQINVADGI 409

  Fly   417 TLIETIKELLENPSYAQRAKEMAASFRDRPMSPLDTAIWWTEYALRNRDTSHMRLNVEEIP 477
            ...|.|.|:::.....:..|||..:.::.                  :.|:...||:..||
plant   410 VKKEVIAEMVKRVMDEEEGKEMRKNVKEL------------------KKTAEEALNMTHIP 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 61/241 (25%)
AT4G36770NP_195395.4 Glycosyltransferase_GTB_type 4..448 CDD:299143 63/250 (25%)
YjiC 6..451 CDD:224732 64/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.