DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and IAGLU

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_567471.1 Gene:IAGLU / 827229 AraportID:AT4G15550 Length:474 Species:Arabidopsis thaliana


Alignment Length:297 Identity:62/297 - (20%)
Similarity:124/297 - (41%) Gaps:82/297 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 FGYPA--EKLDELRARFS-VILVNSHFSM-GRVRANVPNIIEVAGVHLSEPPEPCG--------- 281
            |..||  |::|.|:...: .||:|:...: ....::||:..::.         |.|         
plant   207 FLLPAFREQIDSLKEEINPKILINTFQELEPEAMSSVPDNFKIV---------PVGPLLTLRTDF 262

  Fly   282 ---AELQKYLD-EAEHGAIYFSMGQDILIKYLPENMQKQLLLVFLQMKQRVIW------------ 330
               .|..::|| :|:...:|.|.|   .:..|.:....:|....:|.::..:|            
plant   263 SSRGEYIEWLDTKADSSVLYVSFG---TLAVLSKKQLVELCKALIQSRRPFLWVITDKSYRNKED 324

  Fly   331 ---KSE--LSMLANKSENI-YVMDKVPQRMVLAHPNLRLFITHGGLQSVMEAIDNGVPMLGLPLF 389
               |.|  :|....:.:.| .|:....|..||.|.::..|:||.|..|.:|::.:|||::..|.:
plant   325 EQEKEEDCISSFREELDEIGMVVSWCDQFRVLNHRSIGCFVTHCGWNSTLESLVSGVPVVAFPQW 389

  Fly   390 FDQFNNIHRVQ---LAGMAKVLDPND------LNADTLIETIKELLENPS-----YAQRAKEMAA 440
            .||..|...::   ..|: :|::..:      ::::.:...|:|::|:.:     .|.|.|::||
plant   390 NDQMMNAKLLEDCWKTGV-RVMEKKEEEGVVVVDSEEIRRCIEEVMEDKAEEFRGNATRWKDLAA 453

  Fly   441 SFRDRPMSPLDTAIWWTEYALRNRDTS--HMRLNVEE 475
            .                  |:|...:|  |::..|:|
plant   454 E------------------AVREGGSSFNHLKAFVDE 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 58/282 (21%)
IAGLUNP_567471.1 Glycosyltransferase_GTB_type 12..472 CDD:299143 61/295 (21%)
YjiC 13..455 CDD:224732 56/278 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.