DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and UGT84A4

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_193285.1 Gene:UGT84A4 / 827222 AraportID:AT4G15500 Length:475 Species:Arabidopsis thaliana


Alignment Length:294 Identity:71/294 - (24%)
Similarity:119/294 - (40%) Gaps:66/294 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 PSVYEPISPNGFALDNTFLSRWSNWIYITEEKLLERLVFRPAQVRLFKKFFGYPAEKLDEL---- 240
            ||...|.||.. ::..|.|.:            ::|| .:|..| |.:.|.....:.:|.:    
plant   184 PSFLHPSSPLS-SIGGTILEQ------------IKRL-HKPFSV-LIETFQELEKDTIDHMSQLC 233

  Fly   241 -RARFSVILVNSHFSMGR-VRANVPNIIEVAGVHLSEPPEPCGAELQKYLDEAE-HGAIYFSMGQ 302
             :..|:.|  ...|:|.: :|:::..       .:|:|...|    .::||..| ...:|.|.| 
plant   234 PQVNFNPI--GPLFTMAKTIRSDIKG-------DISKPDSDC----IEWLDSREPSSVVYISFG- 284

  Fly   303 DILIKYLPENMQKQLLLVFLQMKQRVIW--KSELSMLA--------NKSENIYVMDKVPQRMVLA 357
              .:.:|.:|...::....|......:|  :..|..||        ...|...:::...|..|||
plant   285 --TLAFLKQNQIDEIAHGILNSGLSCLWVLRPPLEGLAIEPHVLPLELEEKGKIVEWCQQEKVLA 347

  Fly   358 HPNLRLFITHGGLQSVMEAIDNGVPMLGLPLFFDQFNNI----------HRVQLAGMAKVLDPND 412
            ||.:..|::|.|..|.|||:.:|||::..|.:.||..|.          .|:......:.:.|.:
plant   348 HPAVACFLSHCGWNSTMEALTSGVPVICFPQWGDQVTNAVYMIDVFKTGLRLSRGASDERIVPRE 412

  Fly   413 LNADTLIET-----IKELLENPSYAQRAKEMAAS 441
            ..|:.|:|.     ..||.||   |:|.||.|.|
plant   413 EVAERLLEATVGEKAVELREN---ARRWKEEAES 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 71/294 (24%)
UGT84A4NP_193285.1 PLN02555 1..475 CDD:178170 71/294 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.