DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and UGT84A3

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_193284.1 Gene:UGT84A3 / 827221 AraportID:AT4G15490 Length:479 Species:Arabidopsis thaliana


Alignment Length:453 Identity:98/453 - (21%)
Similarity:160/453 - (35%) Gaps:145/453 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IKALVERGHK--VT-MVTPADYPAKIDGVRHIRVPMLNQLMQNLMKNDQFFDALGDKWREGVLVS 108
            ||.||:|.:|  || ::..|..|...|....:.:|.                  ...|.:.....
plant   103 IKNLVKRYNKEPVTCLINNAFVPWVCDVAEELHIPS------------------AVLWVQSCACL 149

  Fly   109 TIFYNVSHAILNNNGVQMLMRDKSIRFDM-----IMVEASHLDALYGLAEFYNATLLGISCMHMT 168
            |.:|...|.:              ::|..     |.||                    |.|:.:.
plant   150 TAYYYYHHRL--------------VKFPTKTEPDISVE--------------------IPCLPLL 180

  Fly   169 WHIDYLAGNLAPSVYEPISP----NGFALDNTFLSRWSN----WIYITEEKLLERLVFRPAQVRL 225
            .|.:      .||...|.||    ....||.  |.|:.|    :::|...:.||:.:.       
plant   181 KHDE------IPSFLHPSSPYTAFGDIILDQ--LKRFENHKSFYLFIDTFRELEKDIM------- 230

  Fly   226 FKKFFGYPAEKLDELRARFSVILVNSHFSMGRVRANVPNIIEVAGVHLSEPPEPCGAELQKYLDE 290
                     :.:.:|..:..:..|...|.|.:..::     :|.| .:|||...|    .::||.
plant   231 ---------DHMSQLCPQAIISPVGPLFKMAQTLSS-----DVKG-DISEPASDC----MEWLDS 276

  Fly   291 AE-HGAIYFSMGQDILIKYLPENMQKQLLLVFLQMKQRVIWKSELSM-------------LANKS 341
            .| ...:|.|.|   .|..|.:...:::....|.....|:|.....|             |..|.
plant   277 REPSSVVYISFG---TIANLKQEQMEEIAHGVLSSGLSVLWVVRPPMEGTFVEPHVLPRELEEKG 338

  Fly   342 ENIYVMDKVPQRMVLAHPNLRLFITHGGLQSVMEAIDNGVPMLGLPLFFDQFNNIHRVQLAGMAK 406
            :   :::..||..|||||.:..|::|.|..|.|||:..|||::..|.:.||..:  .|.||.:.|
plant   339 K---IVEWCPQERVLAHPAIACFLSHCGWNSTMEALTAGVPVVCFPQWGDQVTD--AVYLADVFK 398

  Fly   407 ------------VLDPNDLNADTLIET-----IKELLENPSYAQRAK-EMAASFRDRPMSPLD 451
                        ::...::.|:.|:|.     ..||.||   |:|.| |..|:..|...|.::
plant   399 TGVRLGRGAAEEMIVSREVVAEKLLEATVGEKAVELREN---ARRWKAEAEAAVADGGSSDMN 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 98/453 (22%)
UGT84A3NP_193284.1 PLN02555 1..479 CDD:178170 98/453 (22%)
YjiC 8..450 CDD:224732 96/443 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.