DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and UGT84A1

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_193283.2 Gene:UGT84A1 / 827220 AraportID:AT4G15480 Length:490 Species:Arabidopsis thaliana


Alignment Length:489 Identity:105/489 - (21%)
Similarity:176/489 - (35%) Gaps:155/489 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PSP---------FQ---MVRPLI---KALVERGHKVTMVTPADYPAKIDGVRHIRVPMLNQLMQN 86
            |||         ||   .|.||:   |.:..:|..||.||...:..|        :...|:::..
plant    13 PSPNPIHVMLVSFQGQGHVNPLLRLGKLIASKGLLVTFVTTELWGKK--------MRQANKIVDG 69

  Fly    87 LMK-------NDQFFDALGDKWRE------------GVLVSTIFYNVSHAILN----NNGVQMLM 128
            .:|       ..:|||   ::|.|            ..|.|.....||..:..    |..|..|:
plant    70 ELKPVGSGSIRFEFFD---EEWAEDDDRRADFSLYIAHLESVGIREVSKLVRRYEEANEPVSCLI 131

  Fly   129 RDKSIRFDMIMVEASHLDALYGLAEFYN---ATLLGISCMHMTWHIDYLAGNLA-PSVYEPISPN 189
            .:..|.:      ..|      :||.:|   |.|...||...:.:..|..|::: |:..||    
plant   132 NNPFIPW------VCH------VAEEFNIPCAVLWVQSCACFSAYYHYQDGSVSFPTETEP---- 180

  Fly   190 GFALD--------------NTFL---SRWSNWIYITEEKLLERLVFRPAQVRLFK---------- 227
              .||              .:||   ||::.              ||.|.:..||          
plant   181 --ELDVKLPCVPVLKNDEIPSFLHPSSRFTG--------------FRQAILGQFKNLSKSFCVLI 229

  Fly   228 -KFFGYPAEKLDELRARFSVILVNSHFSMGRVRANVPNIIEVAGVHLSEPPEPCGAELQKYLD-E 290
             .|.....|.:|.:.:...|..|...|.:.|...:     :|:| .:.:..:.|    .::|| .
plant   230 DSFDSLEQEVIDYMSSLCPVKTVGPLFKVARTVTS-----DVSG-DICKSTDKC----LEWLDSR 284

  Fly   291 AEHGAIYFSMGQDILIKYLPENMQKQLLLVFLQMKQRVIW----------------KSELSMLAN 339
            .:...:|.|.|   .:.||.:...:::....|:.....:|                ..||...:.
plant   285 PKSSVVYISFG---TVAYLKQEQIEEIAHGVLKSGLSFLWVIRPPPHDLKVETHVLPQELKESSA 346

  Fly   340 KSENIYVMDKVPQRMVLAHPNLRLFITHGGLQSVMEAIDNGVPMLGLPLFFDQ----------FN 394
            |.:.: ::|..||..||:||::..|:||.|..|.||::.:|||::..|.:.||          |.
plant   347 KGKGM-IVDWCPQEQVLSHPSVACFVTHCGWNSTMESLSSGVPVVCCPQWGDQVTDAVYLIDVFK 410

  Fly   395 NIHRVQLAGMAKVLDPNDLNADTLIE-TIKELLE 427
            ...|:......:.:.|.:..|:.|:| |:.|..|
plant   411 TGVRLGRGATEERVVPREEVAEKLLEATVGEKAE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 105/489 (21%)
UGT84A1NP_193283.2 PLN02555 17..490 CDD:178170 102/485 (21%)
YjiC 19..477 CDD:224732 102/483 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.