DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and AT4G15260

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_193261.2 Gene:AT4G15260 / 827192 AraportID:AT4G15260 Length:359 Species:Arabidopsis thaliana


Alignment Length:345 Identity:80/345 - (23%)
Similarity:127/345 - (36%) Gaps:99/345 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 NATLLGISCMHMTWHID---YLAGNLAPSVYE----------PISPNGFALDNTFLSRWSNWIYI 207
            |||.|||: :|:....|   |...:|..||.|          |:.    .|.:...|:  :|   
plant    24 NATFLGIT-LHVQEMYDDKKYDVSDLDESVNELEFPCLTRPYPVK----CLPHILSSK--DW--- 78

  Fly   208 TEEKLLERLVFRPAQVRLFKKFFGYPAEKLDELRARFSVILVNSHFSMGRVRANVPNIIEVAGV- 271
                    |.|..||.|.|:|..|.....:.||......:..|         .::|....|..| 
plant    79 --------LPFFAAQGRSFRKMKGILVNTVAELEPHALKMFNN---------VDLPQAYPVGPVL 126

  Fly   272 HL--SEPPEPCGAELQKYLDEAEHGAIYF----SMGQDILIKYLPENMQKQLLLVFLQMKQRVIW 330
            ||  .:..:....|:.::||:....::.|    |||.      ..|...:::.:...:...|.:|
plant   127 HLDNGDDDDEKRLEVLRWLDDQPPKSVLFLCFGSMGG------FTEEQTREVAVALNRSGHRFLW 185

  Fly   331 KSELSMLANKSENIYV---------------------MDK------VPQRMVLAHPNLRLFITHG 368
            .     |...|.||.:                     :|:      .||..||..|.:..|:||.
plant   186 S-----LRRASPNIMMERPGDYKNLEEVLPDGFLERTLDRGKVIGWAPQVAVLEKPAIGGFVTHC 245

  Fly   369 GLQSVMEAIDNGVPMLGLPLFFDQ----FNNIHRVQLAGMAKVLDPNDL---------NADTLIE 420
            |..|::|::..||||:..||:.:|    |..:..:.||...:.....||         .|:.:..
plant   246 GWNSMLESLWFGVPMVTWPLYAEQKVNAFEMVEELGLAVEIRKCISGDLLLIGEMEIVTAEDIER 310

  Fly   421 TIKELLENPS-YAQRAKEMA 439
            .|:.::|..| ...|.||||
plant   311 AIRCVMEQDSDVRSRVKEMA 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 80/345 (23%)
AT4G15260NP_193261.2 Glycosyltransferase_GTB_type <1..359 CDD:299143 80/345 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.