DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and AT4G14090

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_193146.1 Gene:AT4G14090 / 827046 AraportID:AT4G14090 Length:456 Species:Arabidopsis thaliana


Alignment Length:177 Identity:44/177 - (24%)
Similarity:78/177 - (44%) Gaps:24/177 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 KYLD-EAEHGAIYFSMG---QDILIKYLPENMQKQLLLVFLQMKQRVIW-----------KSELS 335
            |:|| :.|...||.|:|   .|     |||...:.|....|...:..:|           |:...
plant   260 KWLDSKLERSVIYISLGTHADD-----LPEKHMEALTHGVLATNRPFLWIVREKNPEEKKKNRFL 319

  Fly   336 MLANKSENIYVMDKVPQRMVLAHPNLRLFITHGGLQSVMEAIDNGVPMLGLPLFFDQFNNIHRVQ 400
            .|...|:...|:....|..||||..:..|:||.|..|.:|::::|||::..|.|.||......|:
plant   320 ELIRGSDRGLVVGWCSQTAVLAHCAVGCFVTHCGWNSTLESLESGVPVVAFPQFADQCTTAKLVE 384

  Fly   401 ----LAGMAKVLDPNDLNADTLIETIKELLENPSYAQRAKEMAASFR 443
                :....||.:..|::.:.:...:::::.....|:..:|.|..::
plant   385 DTWRIGVKVKVGEEGDVDGEEIRRCLEKVMSGGEEAEEMRENAEKWK 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 44/177 (25%)
AT4G14090NP_193146.1 YjiC 11..445 CDD:224732 44/177 (25%)
Glycosyltransferase_GTB_type 12..454 CDD:299143 44/177 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.