DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and AT4G09500

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_974524.1 Gene:AT4G09500 / 826534 AraportID:AT4G09500 Length:442 Species:Arabidopsis thaliana


Alignment Length:491 Identity:98/491 - (19%)
Similarity:167/491 - (34%) Gaps:162/491 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YAWLAFGLLLHLNLYLELGQAANILGVFPYRIPSPFQMVRPLIKALVERGHKVTMVTPAD----- 64
            :.|.|||   |:..:|.|   ||                     .|.|:||:||.:.|..     
plant    10 FPWFAFG---HMIPFLHL---AN---------------------KLAEKGHRVTFLLPKKAQKQL 47

  Fly    65 -----YPAKIDGVRH-IRVPMLNQL-------------MQNLMK------NDQ------------ 92
                 :|..|  |.| :.||.:|.|             :.||:.      .||            
plant    48 EHHNLFPDSI--VFHPLTVPPVNGLPAGAETTSDIPISLDNLLSKALDLTRDQVEAAVRALRPDL 110

  Fly    93 -FFDA---LGDKWREGVLVSTIFYNVSHAILNNN---GVQMLMRDKSIRFDMIMVEASHLDALYG 150
             |||.   :.|..:|.::.|..:..||...:.:.   |.::.:|........:|...:.:.||..
plant   111 IFFDFAQWIPDMAKEHMIKSVSYIIVSATTIAHTHVPGGKLGVRPPGYPSSKVMFRENDVHALAT 175

  Fly   151 LAEFYNATLLGI-----SCMHMTWHIDYLAGNLAPSVYEPISPNGFALDNTFLSR-WSNWIYITE 209
            |:.||......|     ||       |.:|......|      .|...|  |:|| :...:.:|.
plant   176 LSIFYKRLYHQITTGLKSC-------DVIALRTCKEV------EGMFCD--FISRQYHKKVLLTG 225

  Fly   210 EKLLERLVFRPAQVRLFKKFFGYPAEKLDELRARFSVILVNSHFS---MGRVRANVPNIIEVAGV 271
            ....|....:|.:.|......|:..:.:........|||....|.   :|.....:|.::.|   
plant   226 PMFPEPDTSKPLEERWNHFLSGFAPKSVVFCSPGSQVILEKDQFQELCLGMELTGLPFLLAV--- 287

  Fly   272 HLSEPPEPCGAELQKYLDEAEHGAIYFSMGQDILIKYLPENMQKQLLLVFLQMKQR-VIWKSELS 335
               :||.                      |...:.:.|||..::       ::|.| |:|..   
plant   288 ---KPPR----------------------GSSTVQEGLPEGFEE-------RVKDRGVVWGG--- 317

  Fly   336 MLANKSENIYVMDKVPQRMVLAHPNLRLFITHGGLQSVMEAIDNGVPMLGLPLFFDQ--FNNIHR 398
                         .|.|.::||||::..|:.|.|..::.|::.:...|:.:|...||  |..:..
plant   318 -------------WVQQPLILAHPSIGCFVNHCGPGTIWESLVSDCQMVLIPFLSDQVLFTRLMT 369

  Fly   399 VQLAGMAKVLDPND----LNADTLIETIKELLENPS 430
            .:.....:|  |.:    .:.::|...||.:::..|
plant   370 EEFEVSVEV--PREKTGWFSKESLSNAIKSVMDKDS 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 91/472 (19%)
AT4G09500NP_974524.1 PLN02208 1..442 CDD:177858 98/491 (20%)
MGT 8..403 CDD:273616 97/489 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.