DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and AT3G46690

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_190253.1 Gene:AT3G46690 / 823822 AraportID:AT3G46690 Length:452 Species:Arabidopsis thaliana


Alignment Length:301 Identity:63/301 - (20%)
Similarity:102/301 - (33%) Gaps:69/301 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 DYLAGNLAPSVYEPISPNGFALDNTFL--------SRWSNWIYITEEKLLERLVFRPAQVRLFKK 228
            |.:...|.|..|:.:..:||......|        .|.::.:.|.....||.|.....|..|   
plant   166 DKVLEGLHPLRYKDLPTSGFGPLEPLLEMCREVVNKRTASAVIINTASCLESLSLSWLQQEL--- 227

  Fly   229 FFGYPAEKLDELRARFSVILVNSHFSMGRVRANVPNIIEVAGVHLSEPPEPCGAELQKYLDEAEH 293
              |.|...|..|                .:.|:.|      |..|.:....|...|.|   :...
plant   228 --GIPVYPLGPL----------------HITASSP------GPSLLQEDMSCIEWLNK---QKPR 265

  Fly   294 GAIYFSMGQDILIKYLPENMQKQLLLV---FLQMKQRVIWKSELSMLAN--------------KS 341
            ..||.|:|....::      .|::|.:   .|...|..:|......:|.              .:
plant   266 SVIYISLGTKAHME------TKEMLEMAWGLLNSNQPFLWVIRPGSVAGFEWIELLPEEVIKMVT 324

  Fly   342 ENIYVMDKVPQRMVLAHPNLRLFITHGGLQSVMEAIDNGVPMLGLPLFFDQFNNIHRVQLAGMAK 406
            |..|:....||..||.||.:..|.:|.|..|.:|:|..||||:..||..:|..|...::......
plant   325 ERGYIAKWAPQIEVLGHPAVGGFWSHCGWNSTLESIVEGVPMICRPLQGEQKLNAMYIESVWKIG 389

  Fly   407 VLDPNDLNADTLIETIKELLENPSYAQRAKEMAASFRDRPM 447
            :....::..:.:...:|.|:        ..|..|:.|:|.:
plant   390 IQLEGEVEREGVERAVKRLI--------IDEEGAAMRERAL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 63/301 (21%)
AT3G46690NP_190253.1 Glycosyltransferase_GTB_type 1..451 CDD:299143 63/301 (21%)
YjiC 7..431 CDD:224732 63/301 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.