DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and UGT71B8

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_188817.1 Gene:UGT71B8 / 821734 AraportID:AT3G21800 Length:480 Species:Arabidopsis thaliana


Alignment Length:513 Identity:101/513 - (19%)
Similarity:176/513 - (34%) Gaps:139/513 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RLGYAWLAFGLLLHLNLYLELG----QAANILGVFPYRIP-------SPFQMVRPLIKALVERGH 55
            :....::.|.:|.||....|:.    :....|.:....:|       |....:..|..|..:|.|
plant     3 KFALVFVPFPILGHLKSTAEMAKLLVEQETRLSISIIILPLLSGDDVSASAYISALSAASNDRLH 67

  Fly    56 KVTMVTPADYPA---KIDGVRHIRVPMLNQLMQNLMKN---------------DQFFDALGDKWR 102
             ..:::..|.|.   .:|.    .:||:.:.:..|:.:               |.|..::.|...
plant    68 -YEVISDGDQPTVGLHVDN----HIPMVKRTVAKLVDDYSRRPDSPRLAGLVVDMFCISVIDVAN 127

  Fly   103 EGVLVSTIFYNVSHAILNNNGVQMLMRDKSIRFDMIMVEASHLDALYGLAEFYNA-TLLGISCMH 166
            |..:...:||.      :|.|:..|.....:.||......|..|       |.:: .:|.:..:.
plant   128 EVSVPCYLFYT------SNVGILALGLHIQMLFDKKEYSVSETD-------FEDSEVVLDVPSLT 179

  Fly   167 MTWHIDYLAGNLAPSVYEPISPNGFALDNTFLSRWSNWIYITEEKLLERLVFRPAQVRLFKKFFG 231
            ..:.:..|...||...:.|:..|                                |.|.|::..|
plant   180 CPYPVKCLPYGLATKEWLPMYLN--------------------------------QGRRFREMKG 212

  Fly   232 YPAEKLDELRARFSVILVNSHFSMGRVRA-NVPNIIEVAGVHLSEPPEPCGAELQKYLDEAEHGA 295
            .......||.   ...|.:.|.|....|| .|..::.:.. |:....:..|:::.::|||....:
plant   213 ILVNTFAELE---PYALESLHSSGDTPRAYPVGPLLHLEN-HVDGSKDEKGSDILRWLDEQPPKS 273

  Fly   296 IYF----SMGQDILIKYLPENMQKQLLLVFLQMKQRVIWK---------SELSMLANKSENIY-- 345
            :.|    |:|.      ..|...:::.:...:...|.:|.         .||.......|.|.  
plant   274 VVFLCFGSIGG------FNEEQAREMAIALERSGHRFLWSLRRASRDIDKELPGEFKNLEEILPE 332

  Fly   346 -----------VMDKVPQRMVLAHPNLRLFITHGGLQSVMEAIDNGVPMLGLPLFFDQ-FNNIHR 398
                       |:...||..|||.|.:..|:||.|..|::|::..|||:...||:.:| ||....
plant   333 GFFDRTKDKGKVIGWAPQVAVLAKPAIGGFVTHCGWNSILESLWFGVPIAPWPLYAEQKFNAFVM 397

  Fly   399 V----------------QLAGMAKVLDPNDLNADTLIETIKELLENPS-YAQRAKEMA 439
            |                ||.|.|.|:    :.|:.:...|:.|:|..| ...|.|||:
plant   398 VEELGLAVKIRKYWRGDQLVGTATVI----VTAEEIERGIRCLMEQDSDVRNRVKEMS 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 96/487 (20%)
UGT71B8NP_188817.1 PLN02554 2..480 CDD:215304 101/513 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.