DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt303B2 and AT3G21790

DIOPT Version :9

Sequence 1:NP_651154.1 Gene:Ugt303B2 / 42776 FlyBaseID:FBgn0039087 Length:540 Species:Drosophila melanogaster
Sequence 2:NP_188816.1 Gene:AT3G21790 / 821733 AraportID:AT3G21790 Length:495 Species:Arabidopsis thaliana


Alignment Length:460 Identity:92/460 - (20%)
Similarity:154/460 - (33%) Gaps:162/460 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VRPLIKALVERGHKVTMVTPADYPAKIDGVRHIRVPMLNQLMQNLMKNDQFFDALGDKWREGVLV 107
            ||..:..|:|           ||.:|.|.      |.:...:.     |.|..::.|...|....
plant    94 VRSTVAKLLE-----------DYSSKPDS------PKIAGFVL-----DMFCTSMVDVANEFGFP 136

  Fly   108 STIFYNVSHAILN-NNGVQMLMRDKSIRFDMIMVEASHLDALYGLAEFYNATLLGISCMHMTWHI 171
            |.:||..|..||: ...||||..:.  ::|  :.|..:.|         :..:|....:...:.:
plant   137 SYMFYTSSAGILSVTYHVQMLCDEN--KYD--VSENDYAD---------SEAVLNFPSLSRPYPV 188

  Fly   172 DYLAGNLAPSVYEPISPNGFALDNTFLSRWSNWIYITEEKLLERLVFRPAQVRLFKKFFGYPAEK 236
            ..|...||.:::.|:..|                                |.|.|::..|     
plant   189 KCLPHALAANMWLPVFVN--------------------------------QARKFREMKG----- 216

  Fly   237 LDELRARFSVILVNSHFSMGRVRANVPNIIEVAGVHLSEPPEPCG-----------------AEL 284
                      ||||:      |....|.:::......:.|..|.|                 .|:
plant   217 ----------ILVNT------VAELEPYVLKFLSSSDTPPVYPVGPLLHLENQRDDSKDEKRLEI 265

  Fly   285 QKYLDEAEHGAIYF----SMGQDILIKYLPENMQKQLLLVFLQMKQRVIWKSELSMLANKSENIY 345
            .::||:....::.|    |||.      ..|...:::.:...:...|.:|.     |...|.||:
plant   266 IRWLDQQPPSSVVFLCFGSMGG------FGEEQVREIAIALERSGHRFLWS-----LRRASPNIF 319

  Fly   346 ---------------------------VMDKVPQRMVLAHPNLRLFITHGGLQSVMEAIDNGVPM 383
                                       |:...||..|||:|.:..|:||.|..|.:|::..|||.
plant   320 KELPGEFTNLEEVLPEGFFDRTKDIGKVIGWAPQVAVLANPAIGGFVTHCGWNSTLESLWFGVPT 384

  Fly   384 LGLPLFFDQ-FNNIHRVQLAGMA------------KVLDPNDLNADTLIETIKELLENPS-YAQR 434
            ...||:.:| ||....|:..|:|            ..|....:.|:.:.:.|..|:|..| ..:|
plant   385 AAWPLYAEQKFNAFLMVEELGLAVEIRKYWRGEHLAGLPTATVTAEEIEKAIMCLMEQDSDVRKR 449

  Fly   435 AKEMA 439
            .|:|:
plant   450 VKDMS 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt303B2NP_651154.1 egt 24..464 CDD:223071 92/460 (20%)
AT3G21790NP_188816.1 PLN02554 1..483 CDD:215304 92/460 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.